Gene Card
Gene overview
cDNA / CDS / Protein Sequences
354 bp · TkA05G379370|TK1151|cDNA
ATGAACCATTTATGGGAATCAACTTTTACTCCTATGAAAGTCCTCGGAGGTTTAGGCCTGTGGGGTCCAACTTTGGTCCGGAGATATACAAGTGCAAGATTTGGTGAATATTCAACCGGAGACGTGTTGAGATATGAAGAATATAAAATACTTACATATTACATATACCACACTTTGGCGGCTAACGGAAGCGGAGAACTTTGCTTAAAAGTACATCTTCTCATTTGGGGAATATGCTGGAAGTCCTCTTTTGCAAAGGT...
354 bp · TkA05G379370|TK1151|CDS
ATGAACCATTTATGGGAATCAACTTTTACTCCTATGAAAGTCCTCGGAGGTTTAGGCCTGTGGGGTCCAACTTTGGTCCGGAGATATACAAGTGCAAGATTTGGTGAATATTCAACCGGAGACGTGTTGAGATATGAAGAATATAAAATACTTACATATTACATATACCACACTTTGGCGGCTAACGGAAGCGGAGAACTTTGCTTAAAAGTACATCTTCTCATTTGGGGAATATGCTGGAAGTCCTCTTTTGCAAAGGT...
Protein
Download Protein FASTA117 aa · TkA05G379370|TK1151|PROTEIN
MNHLWESTFTPMKVLGGLGLWGPTLVRRYTSARFGEYSTGDVLRYEEYKILTYYIYHTLAANGSGELCLKVHLLIWGICWKSSFAKVRLFTAIIIKRSHIHFISLCSLSVMDEILYW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G379370 |
|---|---|
| TK1151 ID | TkA05G379370 |
| OH-1004 ID | LXL04_023692 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 88.800 |
| Protein coverage (%) | TK1151 91.453 / OH-1004 32.822Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G379370 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:94257774-94258740 (+) | ||||||||||||
| Description | Similar to Os09g0520200: Probable 1-acylglycerol-3-phosphate O-acyltransferase | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006654 phosphatidic acid biosynthetic process Biological Process GO:0055088 lipid homeostasis Biological Process GO:0055089 fatty acid homeostasis Biological Process GO:0055091 phospholipid homeostasis Biological Process GO:0070328 triglyceride homeostasis Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0003841 1-acylglycerol-3-phosphate O-acyltransferase activity Molecular Function GO:0004623 A2-type glycerophospholipase activity Molecular Function GO:0016298 lipase activity Molecular Function GO:0042171 lysophosphatidic acid acyltransferase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT4G24160 dosa:Os09g0520200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.