RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G379110
Reference: TK1151 Chr: Chr05 Coordinates: 94186865-94188994 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1429 bp · TkA05G379110|TK1151|cDNA

CTTATACCTCCTTGCAGGAAGTATGTAGTTCATCCTGCTCCCCTTTTCTCTTTCAAATGGCTCCCCCTCTCTCTAGATTAATCGAGAATTTATTCATCTGATTTTATTCTTCAAACAAGAATCAAGCAACAATTTCATTGTAGAACCGCTATTTTAGTTCAGGGAACAATTTATTGAGAAAATGCAGAACTACACCGATTTTCCGTTCAGTGGCGACGAAGACAACAAACTGTGGACTTCGTTCATCGAACAATCGGACG...

CDS

Download CDS FASTA

993 bp · TkA05G379110|TK1151|CDS

ATGCAGAACTACACCGATTTTCCGTTCAGTGGCGACGAAGACAACAAACTGTGGACTTCGTTCATCGAACAATCGGACGGCAGCGCGTATGATGATTTCGACACATCTCTTTACTCTCCGATCTTCCCTACCAGTACTCCACCTCATCACTTCCCCGGAACTCCAAACACGGCATCCCTTCCACTACCGCCGATCGTCCTTGATTATAGCCGCAAACATTCAATGGATTTTGCTCCGTTTCAAGATCTAATCGACCGCCG...

Protein

Download Protein FASTA

330 aa · TkA05G379110|TK1151|PROTEIN

MQNYTDFPFSGDEDNKLWTSFIEQSDGSAYDDFDTSLYSPIFPTSTPPHHFPGTPNTASLPLPPIVLDYSRKHSMDFAPFQDLIDRRNWCLSNLRLTAKEAEALRQENVNLHMANSELNKQLSHLQQQAASASSLQNYANATIYPSTKALADRFGRMRVGEKGPTATDKRSAARGVENVDPVKKTEAERVKLPKSISVRSNGYLKTIQAGDGTAGRPRAVDRVKTGSDTQRVYVRGKKEEAPLELQVYNQGMTKTELCNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G379110
TK1151 IDTkA05G379110
OH-1004 IDLXL04_009520
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)90.700
Protein coverage (%)TK1151 22.727 / OH-1004 86.207
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G379110
LocationChr05:94186865-94188994 (+)
DescriptionProtein of unknown function
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g68200 Functions probably as a transcriptional factor that activates genes involved in secondary cell wall biosynthesis.
The Arabidopsis CALLOSE DEFECTIVE MICROSPORE1 gene is required for male fertility through regulating callose metabolism during microsporogenesis.2014 · DOI: 10.1104/pp.113.233387
Arabidopsis C3H14 and C3H15 have overlapping roles in the regulation of secondary wall thickening and anther development.2015 · DOI: 10.1093/jxb/erv060
The CCCH zinc finger protein C3H15 negatively regulates cell elongation by inhibiting brassinosteroid signaling.2022 · DOI: 10.1093/plphys/kiac046
At1g66810 Functions probably as a transcriptional factor that activates genes involved in secondary cell wall biosynthesis.
AtC3H14, a plant-specific tandem CCCH zinc-finger protein, binds to its target mRNAs in a sequence-specific manner and affects cell elongation in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12667
Arabidopsis C3H14 and C3H15 have overlapping roles in the regulation of secondary wall thickening and anther development.2015 · DOI: 10.1093/jxb/erv060

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0645000 Zinc finger CCCH domain-containing protein 9. No verified direct reference in this release
Os05g0576300 Zinc finger CCCH domain-containing protein 39. No verified direct reference in this release
Os03g0301500 Putative zinc finger CCCH domain-containing protein 21. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009520 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)No functional description available
KEGG gene cross-referenceNo functional description available
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.597
Rank 1 · TkA05G379110 · TK1151
Nucleus0.430
Rank 2 · TkA05G379110 · TK1151
Cell membrane0.063
Rank 3 · TkA05G379110 · TK1151
Mitochondrion0.051
Rank 4 · TkA05G379110 · TK1151
Endoplasmic reticulum0.041
Rank 5 · TkA05G379110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20992CBP66_2nd247-290 aa
PF16131Torus250-280 aa
PF14625Lustrin_cystein253-276 aa
PF00642zf-CCCH254-278 aa
PF25585zf-CCCH_DUS3L254-277 aa
PF25427zf-CCCH_UNK254-284 aa
PF18044zf-CCCH_4257-277 aa
PF25542zf-CCCH_12257-278 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G379110PF20992CBP66_2nd2472900.07213.8
TkA05G379110PF16131Torus2502800.002519.0
TkA05G379110PF14625Lustrin_cystein2532760.008217.2
TkA05G379110PF00642zf-CCCH2542782.3e-1556.8
TkA05G379110PF25585zf-CCCH_DUS3L2542772.4e-0834.5
TkA05G379110PF25427zf-CCCH_UNK2542847.7e-0523.2
TkA05G379110PF18044zf-CCCH_42572774.9e-1039.6
TkA05G379110PF25542zf-CCCH_122572780.001319.0
TkA05G379110PF25261zf-CCCH_PARP122572800.007917.1
TkA05G379110PF18345zf_CCCH_42582775.2e-0627.1
TkA05G379110PF14608zf-CCCH_22582780.0007620.6
TkA05G379110PF22623zf-CCCH_92582770.2611.8
TkA05G379110PF23261zf-CCCH_112602780.2511.6
TkA05G379110PF25543zf-CCCH_tandem2642773.18.7
TkA05G379110PF06357Omega-toxin2672731.19.9
TkA05G379110PF00642zf-CCCH2913152.3e-1556.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C9F5Arabidopsis thalianasp|Q9C9F5|C3H15_ARATH Zinc finger CCCH domain-containing protein 1547.000%Swiss-ProtMedium
Q9C9N3Arabidopsis thalianasp|Q9C9N3|C3H14_ARATH Zinc finger CCCH domain-containing protein 1456.900%Swiss-ProtLow
A2ZVY5Oryza sativa subsp. japonicasp|A2ZVY5|C3H9_ORYSJ Zinc finger CCCH domain-containing protein 941.400%Swiss-ProtMedium
Q6L5G1Oryza sativa subsp. japonicasp|Q6L5G1|C3H39_ORYSJ Zinc finger CCCH domain-containing protein 3944.400%Swiss-ProtMedium
Q10MN8Oryza sativa subsp. japonicasp|Q10MN8|C3H21_ORYSJ Putative zinc finger CCCH domain-containing protein 2143.800%Swiss-ProtLow

JBrowse

View in Genome Browser