TkA05G346460 | RubberDandelionOmics

Gene overview

TkA05G346460

Reference: TK1151 Chr: Chr05 Coordinates: 85879411-85880934 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

983 bp · TkA05G346460|TK1151|cDNA

CATTTTGGTTTCATACCTTTTCATACCCATAATCTTAACCCTATAAATACACACAATAAGCACACCCTCATTCACACAAACTTATAGACATGAAGATGCAATCTAACATTGCTTCGCTCTTGATCAAGCTCTTAACGGTGCATTCACTACTCCTACTCTCTGCTTCACAAGACTTCGATTTCTTCTACTTTGTTCAACAGTGGCCAGGATCGTACTGTGACACGAAACAAGGTTGTTGCTATCCAAGCACGGGTAAACCG...

CDS

Download CDS FASTA

693 bp · TkA05G346460|TK1151|CDS

ATGAAGATGCAATCTAACATTGCTTCGCTCTTGATCAAGCTCTTAACGGTGCATTCACTACTCCTACTCTCTGCTTCACAAGACTTCGATTTCTTCTACTTTGTTCAACAGTGGCCAGGATCGTACTGTGACACGAAACAAGGTTGTTGCTATCCAAGCACGGGTAAACCGGCATCCGACTTTGGAATCCATGGGCTTTGGCCTAACAGAAATGATGGATCCTATCCTTCCAATTGCGACTCTAGCAGCCCTTTTGATGC...

Protein

Download Protein FASTA

230 aa · TkA05G346460|TK1151|PROTEIN

MKMQSNIASLLIKLLTVHSLLLLSASQDFDFFYFVQQWPGSYCDTKQGCCYPSTGKPASDFGIHGLWPNRNDGSYPSNCDSSSPFDASKISDLTNRMRSEWPTLSCPSNNGLTFWGHEWDKHGTCSESVLNQHAYFATALTLKNEINILQALQSAGIQPNGQKYSLTSIKDAIKGASGYTPWIECNNDSSSGNSQLYQVYFCVDSSASSFIECPVFPNGSCASSVEFPSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G346460`
TK1151 ID	TkA05G346460
OH-1004 ID	LXL04_021053
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G346460

Location Chr05:85879411-85880934 (+)

Description Similar to Extracellular ribonuclease LE

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02990`	May remobilize phosphate, particularly when cells senesce or when phosphate becomes limiting.	No verified direct reference in this release
`At1g26820`	May remobilize phosphate, particularly when cells senesce or when phosphate becomes limiting.	No verified direct reference in this release
`At2g39780`	May remobilize phosphate, particularly when cells senesce or when phosphate becomes limiting.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006401 RNA catabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0004521 RNA endonuclease activity Molecular Function

GO:0004540 RNA nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26820

ath:AT2G02990

ddi:DDB_G0281293

sly:544098

sly:544193

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.395

Rank 1 · TkA05G346460 · TK1151

Lysosome / Vacuole0.373

Rank 2 · TkA05G346460 · TK1151

Cytoplasm0.164

Rank 3 · TkA05G346460 · TK1151

Endoplasmic reticulum0.122

Rank 4 · TkA05G346460 · TK1151

Cell membrane0.096

Rank 5 · TkA05G346460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00445Ribonuclease_T229-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G346460	`PF00445`	Ribonuclease_T2	29	213	5.3e-64	216.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42813`	Arabidopsis thaliana	sp\|P42813\|RNS1_ARATH Ribonuclease 1	68.100%	Swiss-Prot	High
`P42815`	Arabidopsis thaliana	sp\|P42815\|RNS3_ARATH Ribonuclease 3	58.100%	Swiss-Prot	High
`P42814`	Arabidopsis thaliana	sp\|P42814\|RNS2_ARATH Ribonuclease 2	42.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card