TkA05G332990 | RubberDandelionOmics

Gene overview

TkA05G332990

Reference: TK1151 Chr: Chr05 Coordinates: 81989179-81991003 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1656 bp · TkA05G332990|TK1151|cDNA

TTGCACTAAAATTGTAAATTAAACGAAAGTGTTAGGACCAATTTTGTAACTTACTAAAGATATTAATTCTCAGTCGTCGTTTGCACTACTCAACCCACCAAACTCCATCTTGACAAAATTGAATCTCCGGCGATCATGGGTGGCACAACGACTTCCCCGACGGCGGACGCTACTGCCTTTGACGACTCCGAATCACCATCGCTCCCGCTCCTTCCAGAGCCCAACGCCAAAGCCCCCGAAGACTCGTACCATTTAGCCTA...

CDS

Download CDS FASTA

1260 bp · TkA05G332990|TK1151|CDS

ATGGGTGGCACAACGACTTCCCCGACGGCGGACGCTACTGCCTTTGACGACTCCGAATCACCATCGCTCCCGCTCCTTCCAGAGCCCAACGCCAAAGCCCCCGAAGACTCGTACCATTTAGCCTACATAATCTACTTCATCCTTGGCATCGGTTACTTGATTCCATGGAACGCATTCATCACAGCCGTCGATTACTTCTCATATCTCTACCCCGATGCCTCCGTCGATCGTGTTTTCGCCGTCGTTTACATGGTTGTAGG...

Protein

Download Protein FASTA

419 aa · TkA05G332990|TK1151|PROTEIN

MGGTTTSPTADATAFDDSESPSLPLLPEPNAKAPEDSYHLAYIIYFILGIGYLIPWNAFITAVDYFSYLYPDASVDRVFAVVYMVVGLVSLFIIIFYANKSHSFVRINVGLGLFVVSLLVVPVMDVTYIKGQVGVYGGFYVSVAAIALSGVADALAQGGVIGAAGEMPERYMQAVVAGTAASGVLISILRIFTKAVYSQDASGLRKSANLYFIVSIIVMIICIVLHNLAHRLPVIKHYKELKIQAVNTEKEEKGAVTGAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G332990`
TK1151 ID	TkA05G332990
OH-1004 ID	LXL04_028055
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.200
Protein coverage (%)	TK1151 91.885 / OH-1004 96.701 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G332990

Location Chr05:81989179-81991003 (+)

Description Similar to ETN8: Equilibrative nucleotide transporter 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70330`	Nucleoside transporter involved in adenosine transport and required for nucleotide metabolism which influences growth and pollen germination.	Characterisation of a concentrative type of adenosine transporter from Arabidopsis thaliana (ENT1,At).2001 · DOI: 10.1016/s0014-5793(01)03195-7 Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389 Equilibrative nucleoside transporter 1 (ENT1) is critical for pollen germination and vegetative growth in Arabidopsis.2011 · DOI: 10.1093/jxb/err183
`At1g02630`	May be involved in nucleoside transport.	No verified direct reference in this release
`At3g09990`	May be involved in nucleoside transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028055 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015858 nucleoside transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005337 nucleoside transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G02630

ath:AT1G61630

ath:AT1G70330

ath:AT3G09990

ath:AT4G05130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.377

Rank 1 · TkA05G332990 · TK1151

Lysosome / Vacuole0.318

Rank 2 · TkA05G332990 · TK1151

Endoplasmic reticulum0.166

Rank 3 · TkA05G332990 · TK1151

Cytoplasm0.115

Rank 4 · TkA05G332990 · TK1151

Golgi apparatus0.096

Rank 5 · TkA05G332990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29155DDB_G028114528-96 aa

PF083957tm_740-98 aa

PF01733Nucleoside_tran88-123 aa

PF29155DDB_G0281145107-148 aa

PF01733Nucleoside_tran144-253 aa

PF083957tm_7175-304 aa

PF29155DDB_G0281145201-225 aa

PF01733Nucleoside_tran262-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G332990	`PF29155`	DDB_G0281145	28	96	0.045	15.0
TkA05G332990	`PF08395`	7tm_7	40	98	0.0022	18.1
TkA05G332990	`PF01733`	Nucleoside_tran	88	123	7.6e-72	243.0
TkA05G332990	`PF29155`	DDB_G0281145	107	148	0.045	15.0
TkA05G332990	`PF01733`	Nucleoside_tran	144	253	7.6e-72	243.0
TkA05G332990	`PF08395`	7tm_7	175	304	0.0022	18.1
TkA05G332990	`PF29155`	DDB_G0281145	201	225	0.045	15.0
TkA05G332990	`PF01733`	Nucleoside_tran	262	419	7.6e-72	243.0
TkA05G332990	`PF29155`	DDB_G0281145	304	348	0.045	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXY7`	Arabidopsis thaliana	sp\|Q8VXY7\|ENT1_ARATH Equilibrative nucleotide transporter 1	68.200%	Swiss-Prot	High
`Q84XI3`	Arabidopsis thaliana	sp\|Q84XI3\|ENT8_ARATH Equilibrative nucleotide transporter 8	44.000%	Swiss-Prot	Medium
`Q9SR64`	Arabidopsis thaliana	sp\|Q9SR64\|ENT2_ARATH Equilibrative nucleotide transporter 2	29.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card