TkA05G318980 | RubberDandelionOmics

Gene overview

TkA05G318980

Reference: TK1151 Chr: Chr05 Coordinates: 78724171-78728328 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1361 bp · TkA05G318980|TK1151|cDNA

TCAAAATTAGCCCATTTGGTGCGTTATCGGATAAGATAACGAAATCTTTAACCACCGTTCCCAAACTTTCATACAACGACACTTTCCCTCCATTTCCTTCCCAATTCGCTATCACCATCGCCACCGCCACTGCCATTACAGCCATAATCTGATATCCATGGCTGCCGGCATTCAAGAGAAAGACCTAGACACTGTGACGAGGAGAGTTGCCACCGTCAGTAACCACCTCCTTCCTCCACTACCTTGTTCGATTTCCCCAA...

CDS

Download CDS FASTA

1014 bp · TkA05G318980|TK1151|CDS

ATGGCTGCCGGCATTCAAGAGAAAGACCTAGACACTGTGACGAGGAGAGTTGCCACCGTCAGTAACCACCTCCTTCCTCCACTACCTTGTTCGATTTCCCCAATTATAAGTTCGTCTAACTGCAGCGCTTCCATGAGCGATAGCTATCATCGTATTCACGGTCAAGTGCCGAGTCATTTGCCTGTTTGGAAAACCTCGTGTGATGAGTCAGGGAAGGAGTTCACTGACATTATTTACGAGAAAGCTGAAGGAGAAGCCAT...

Protein

Download Protein FASTA

337 aa · TkA05G318980|TK1151|PROTEIN

MAAGIQEKDLDTVTRRVATVSNHLLPPLPCSISPIISSSNCSASMSDSYHRIHGQVPSHLPVWKTSCDESGKEFTDIIYEKAEGEAIAKITINRPERRNAFRPHTVKELIRAFNDARDDSTIGVIILTGKGTKAFCSGGDQALRSQDGYADFENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVGPKKAREMWFLARFYTAQEAEKMGLINTVVPLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G318980`
TK1151 ID	TkA05G318980
OH-1004 ID	LXL04_032333
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	32.400
Protein coverage (%)	TK1151 65.875 / OH-1004 81.132 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G318980

Location Chr05:78724171-78728328 (-)

Description Similar to ECHIA: Probable enoyl-CoA hydratase 1, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60550`	Involved in the biosynthesis of phylloquinone (vitamin K1).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032333 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0019605 butyrate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0018812 3-hydroxyacyl-CoA dehydratase activity Molecular Function

GO:0043956 3-hydroxypropionyl-CoA dehydratase activity Molecular Function

GO:0120092 (2E)-butenoyl-CoA hydratase activity Molecular Function

KEGG gene cross-reference

ath:AT4G16210

cac:CA_C2712

ddi:DDB_G0285071

mtu:Rv1070c

mtv:RVBD_1070c

swo:Swol_1936

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.540

Rank 1 · TkA05G318980 · TK1151

Mitochondrion0.278

Rank 2 · TkA05G318980 · TK1151

Cytoplasm0.130

Rank 3 · TkA05G318980 · TK1151

Plastid0.090

Rank 4 · TkA05G318980 · TK1151

Nucleus0.053

Rank 5 · TkA05G318980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378ECH_184-331 aa

PF16113ECH_288-263 aa

PF01972SDH_protease107-131 aa

PF01039Carboxyl_trans137-221 aa

PF01343Peptidase_S49171-208 aa

PF01972SDH_protease172-217 aa

PF01343Peptidase_S49240-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G318980	`PF00378`	ECH_1	84	331	1.2e-74	251.6
TkA05G318980	`PF16113`	ECH_2	88	263	2.4e-21	77.3
TkA05G318980	`PF01972`	SDH_protease	107	131	0.034	13.9
TkA05G318980	`PF01039`	Carboxyl_trans	137	221	0.013	14.8
TkA05G318980	`PF01343`	Peptidase_S49	171	208	0.037	14.7
TkA05G318980	`PF01972`	SDH_protease	172	217	0.034	13.9
TkA05G318980	`PF01343`	Peptidase_S49	240	261	0.037	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYN9`	Arabidopsis thaliana	sp\|Q8GYN9\|MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal	77.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card