RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G311910
Reference: TK1151 Chr: Chr05 Coordinates: 76976103-76976918 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

686 bp · TkA05G311910|TK1151|cDNA

TTATACTCAATCAGGTTTAATTCATCGCTAATTTCTTTGTAAACTGTTACAAATCAAAACCATTTTTTTGCAAAATTGTTATATGTTACAAACAGTTGATCGCTGAGGGTTCATTATAAAAGAAGCCGATGTAAGGAGATCATCCGATGAGGAACCCAATTTCATCCGACTACCGAAGGGGAGGCAGTCAAGTACAAGAGCTCACTAGACGCCTTCAACCAAAATCCTGAAGAACGAAGGAGCCAAATCTCTCTTCAAGG...

CDS

Download CDS FASTA

423 bp · TkA05G311910|TK1151|CDS

ATGGGGCCAACATCCTCCGAGCCATTGCTGGTGCTGGTGTCCTCTCTGGATACGACAAGTTGCAGCTTATTGTTTTTGGCAAGAAGTACGGATCAGGCGGCGGCTAATTCCCTGCTTTTCCTTCCTCAATTAGATGGTGACGAACGACTTCTTTTGGTATTTGAGGGTTTCTTTTGTTTTGCAATAATAACTCAGTTTTTTTGGGAGACGGTAAAATGGATATTTATGTTGATGAAATGGAGACCCGTTTATGATTCTAG...

Protein

Download Protein FASTA

140 aa · TkA05G311910|TK1151|PROTEIN

MGPTSSEPLLVLVSSLDTTSCSLLFLARSTDQAAANSLLFLPQLDGDERLLLVFEGFFCFAIITQFFWETVKWIFMLMKWRPVYDSRSRYFIFHLLLFINSTYLNIIPINNCNFDEDLWYLIVGYNIESFVCQLFAKMLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G311910
TK1151 IDTkA05G311910
OH-1004 IDLXL04_035467
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 72.143 / OH-1004 50.249
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G311910
LocationChr05:76976103-76976918 (-)
DescriptionSimilar to AAC1: ADP,ATP carrier protein 1, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035467 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0015865 purine nucleotide transport Biological Process
GO:0046902 regulation of mitochondrial membrane permeability Biological Process
GO:0140021 mitochondrial ADP transmembrane transport Biological Process
GO:1990544 mitochondrial ATP transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005740 mitochondrial envelope Cellular Component
GO:0005743 mitochondrial inner membrane Cellular Component
GO:0005757 mitochondrial permeability transition pore complex Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
ath:AT3G08580
ath:AT4G28390
ath:AT5G13490
ghi:107926278
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.347
Rank 1 · TkA05G311910 · TK1151
Cytoplasm0.322
Rank 2 · TkA05G311910 · TK1151
Endoplasmic reticulum0.198
Rank 3 · TkA05G311910 · TK1151
Cell membrane0.144
Rank 4 · TkA05G311910 · TK1151
Mitochondrion0.125
Rank 5 · TkA05G311910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser