LXL04_035467 | RubberDandelionOmics

Gene overview

LXL04_035467

Reference: OH-1004 Chr: Chr08 Coordinates: 23145395-23146249 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · LXL04_035467|LXL04_035467|OH1004|cDNA

ATGCCGAATGGATGGAGCCATTCAACTGGAACTGGCGGTTATACTCAATCAGAAGCCGATGTAAGGAGATCATCCGATGAGGAACCCAATTTCATCCGACTACCGAAGGGGAGGCAGTCAAGTACAAGAGCTCACTGGACGCCTTCAACCAAAATCCTGAAGAACGAAGGAGCCAAGTCTCTCTTCAAGGGTGATGGGGCCAACATCCTCCGAGCCATTGCTGGTGCTGGTGTCCTCTCTGGATACGACAAGTTGCAGCT...

CDS

Download CDS FASTA

606 bp · LXL04_035467|LXL04_035467|OH1004|CDS

ATGCCGAATGGATGGAGCCATTCAACTGGAACTGGCGGTTATACTCAATCAGAAGCCGATGTAAGGAGATCATCCGATGAGGAACCCAATTTCATCCGACTACCGAAGGGGAGGCAGTCAAGTACAAGAGCTCACTGGACGCCTTCAACCAAAATCCTGAAGAACGAAGGAGCCAAGTCTCTCTTCAAGGGTGATGGGGCCAACATCCTCCGAGCCATTGCTGGTGCTGGTGTCCTCTCTGGATACGACAAGTTGCAGCT...

Protein

Download Protein FASTA

201 aa · LXL04_035467|LXL04_035467|OH1004|PROTEIN

MPNGWSHSTGTGGYTQSEADVRRSSDEEPNFIRLPKGRQSSTRAHWTPSTKILKNEGAKSLFKGDGANILRAIAGAGVLSGYDKLQLIVFGKKRRLIPCFFLPQLDGDERLLLVFEGFFCFAIITQFFWETVKWIFMLMKWRPVYDSRSRYFIFHLLLFINSTYLNIIPINNCNFDEDLWYLIVGYNIESFVCQLFAKMLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035467`
TK1151 ID	TkA05G311910
OH-1004 ID	LXL04_035467
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 72.143 / OH-1004 50.249 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035467

Location Chr08:23145395-23146249 (-)

Description Similar to AAC1: ADP,ATP carrier protein 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08580`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release
`At4g28390`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release
`At5g13490`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015865 purine nucleotide transport Biological Process

GO:0046902 regulation of mitochondrial membrane permeability Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005757 mitochondrial permeability transition pore complex Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G08580

ath:AT4G28390

ath:AT5G13490

ghi:107926278

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.434

Rank 1 · LXL04_035467 · OH-1004

Cytoplasm0.204

Rank 2 · LXL04_035467 · OH-1004

Nucleus0.129

Rank 3 · LXL04_035467 · OH-1004

Endoplasmic reticulum0.095

Rank 4 · LXL04_035467 · OH-1004

Peroxisome0.093

Rank 5 · LXL04_035467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P31167`	Arabidopsis thaliana	ADP/ATP translocase 1, mitochondrial	53.333%	Swiss-Prot	weak database homology
`O49447`	Arabidopsis thaliana	ADP/ATP translocase 3, mitochondrial	50.000%	Swiss-Prot	weak database homology
`P40941`	Arabidopsis thaliana	ADP/ATP translocase 2, mitochondrial	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card