TkA05G210960 | RubberDandelionOmics

Gene overview

TkA05G210960

Reference: TK1151 Chr: Chr05 Coordinates: 53125265-53126012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA05G210960|TK1151|cDNA

ATGACTGCAATTTTAGAGAGACGCGAAAGCGAAAGCCTATGGGGTCGCTTCTGTAACTGGATAACCAGCACCGAAAACCGTCTTTACATTGGATGGTTTGGTGTTTTGATGATCCCTACCTTATTGACCGCAACTTCTGTATTTATTATCGCCTTCATTGCTGCTCCTCCAGTGGATATTGATGGTGCCATTATTCCTACTTCTGCAGCTATAGGTTTGCATTTTTACCCAATATGGGAAGCAGCATCCGTTGGTGTAGC...

CDS

Download CDS FASTA

495 bp · TkA05G210960|TK1151|CDS

ATGACTGCAATTTTAGAGAGACGCGAAAGCGAAAGCCTATGGGGTCGCTTCTGTAACTGGATAACCAGCACCGAAAACCGTCTTTACATTGGATGGTTTGGTGTTTTGATGATCCCTACCTTATTGACCGCAACTTCTGTATTTATTATCGCCTTCATTGCTGCTCCTCCAGTGGATATTGATGGTGCCATTATTCCTACTTCTGCAGCTATAGGTTTGCATTTTTACCCAATATGGGAAGCAGCATCCGTTGGTGTAGC...

Protein

Download Protein FASTA

164 aa · TkA05G210960|TK1151|PROTEIN

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGAIIPTSAAIGLHFYPIWEAASVGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGKPQKMNLLMKVTDSVKKKKLITS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G210960`
TK1151 ID	TkA05G210960
OH-1004 ID	LXL04_040113
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.400
Protein coverage (%)	TK1151 85.976 / OH-1004 27.427 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G210960

Location Chr05:53125265-53126012 (-)

Description Similar to psbA: Photosystem II protein D1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`AtCg00020`	Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_040113 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009635 response to herbicide Biological Process

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0009523 photosystem II Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0010242 oxygen evolving activity Molecular Function

GO:0016168 chlorophyll binding Molecular Function

GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor Molecular Function

KEGG gene cross-reference

nta:800514

sly:3950408

soe:2715607

sot:4099946

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.581

Rank 1 · TkA05G210960 · TK1151

Endoplasmic reticulum0.124

Rank 2 · TkA05G210960 · TK1151

Mitochondrion0.093

Rank 3 · TkA05G210960 · TK1151

Golgi apparatus0.084

Rank 4 · TkA05G210960 · TK1151

Cytoplasm0.073

Rank 5 · TkA05G210960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00124Photo_RC28-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G210960	`PF00124`	Photo_RC	28	142	3e-33	115.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P83755`	Arabidopsis thaliana	sp\|P83755\|PSBA_ARATH Photosystem II protein D1	79.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card