TkA05G186140 | RubberDandelionOmics

Gene overview

TkA05G186140

Reference: TK1151 Chr: Chr05 Coordinates: 47365812-47366546 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · TkA05G186140|TK1151|cDNA

ATGATTGAGAAACTGCTACTTATGCTCAGAGATCCTGACTTCCGTGTTAGATTTTCACTAGCAAGAAGAATTGGTGTTCTTTTCCAAACATGGGATGGCCATGATGAGCTCTTTCAAGACATACTGTCAAATTTTAGTGTAAAATTGGTGGTGTTATTTAAGAATAAGCTCGTTAAAGCCAACGAGGTTTTAGCTGCTGGTCATCAACCACGTCCTAGGATGGAAACCATCATTGTAACCCTCGTGCATCTTGCCCTTCA...

CDS

Download CDS FASTA

456 bp · TkA05G186140|TK1151|CDS

ATGATTGAGAAACTGCTACTTATGCTCAGAGATCCTGACTTCCGTGTTAGATTTTCACTAGCAAGAAGAATTGGTGTTCTTTTCCAAACATGGGATGGCCATGATGAGCTCTTTCAAGACATACTGTCAAATTTTAGTGTAAAATTGGTGGTGTTATTTAAGAATAAGCTCGTTAAAGCCAACGAGGTTTTAGCTGCTGGTCATCAACCACGTCCTAGGATGGAAACCATCATTGTAACCCTCGTGCATCTTGCCCTTCA...

Protein

Download Protein FASTA

151 aa · TkA05G186140|TK1151|PROTEIN

MIEKLLLMLRDPDFRVRFSLARRIGVLFQTWDGHDELFQDILSNFSVKLVVLFKNKLVKANEVLAAGHQPRPRMETIIVTLVHLALHSEKIELEAVFMICVIAAIHSSLRELVAAVLDNLSKKLQYNSRSEVFIFLCSLPLILISLAYNAN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G186140`
TK1151 ID	TkA05G186140
OH-1004 ID	LXL04_007171
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 53.546 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G186140

Location Chr05:47365812-47366546 (+)

Description Similar to ATM: Serine/threonine-protein kinase ATM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48190`	Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR) or DNA replication stalling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007171 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0033044 regulation of chromosome organization Biological Process

GO:0043247 telomere maintenance in response to DNA damage Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

GO:0051321 meiotic cell cycle Biological Process

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · TkA05G186140 · TK1151

Nucleus0.413

Rank 2 · TkA05G186140 · TK1151

Endoplasmic reticulum0.089

Rank 3 · TkA05G186140 · TK1151

Golgi apparatus0.084

Rank 4 · TkA05G186140 · TK1151

Mitochondrion0.077

Rank 5 · TkA05G186140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02985HEAT2-29 aa

PF30718HEAT_Spiral_Tel14-44 aa

PF05527TNFAIP845-138 aa

PF14770TMEM1877-147 aa

PF30718HEAT_Spiral_Tel1106-141 aa

PF02985HEAT108-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G186140	`PF02985`	HEAT	2	29	0.023	15.6
TkA05G186140	`PF30718`	HEAT_Spiral_Tel1	4	44	0.0062	15.3
TkA05G186140	`PF05527`	TNFAIP8	45	138	0.018	15.6
TkA05G186140	`PF14770`	TMEM18	77	147	0.11	13.2
TkA05G186140	`PF30718`	HEAT_Spiral_Tel1	106	141	0.0062	15.3
TkA05G186140	`PF02985`	HEAT	108	123	0.023	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3G7`	Arabidopsis thaliana	sp\|Q9M3G7\|ATM_ARATH Serine/threonine-protein kinase ATM	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card