TkA05G172260 | RubberDandelionOmics

Gene overview

TkA05G172260

Reference: TK1151 Chr: Chr05 Coordinates: 44156610-44157106 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA05G172260|TK1151|cDNA

ATGAAAAAAGAGCCAATCATTTATGGTGGGGAGAAGACTACATGTGAGATGATAAGTAGTGAAAGGAACAATAAGATACGCCTTGTATGGACTCCAGAACTACATGCAAAGTTCATGAATGCTATCAGTCAACTAGGTGAAAGAAAGTGTGCTCCCAAGTTGATACATGAGCTGATGGGCGTACCTGGCATTACAAGAGCACAAATTTCCAGTCACTTACAGGTTAGCTATCTACCTATACAAGAAATTATTTCATTTAC...

CDS

Download CDS FASTA

396 bp · TkA05G172260|TK1151|CDS

ATGAAAAAAGAGCCAATCATTTATGGTGGGGAGAAGACTACATGTGAGATGATAAGTAGTGAAAGGAACAATAAGATACGCCTTGTATGGACTCCAGAACTACATGCAAAGTTCATGAATGCTATCAGTCAACTAGGTGAAAGAAAGTGTGCTCCCAAGTTGATACATGAGCTGATGGGCGTACCTGGCATTACAAGAGCACAAATTTCCAGTCACTTACAGGTTAGCTATCTACCTATACAAGAAATTATTTCATTTAC...

Protein

Download Protein FASTA

131 aa · TkA05G172260|TK1151|PROTEIN

MKKEPIIYGGEKTTCEMISSERNNKIRLVWTPELHAKFMNAISQLGERKCAPKLIHELMGVPGITRAQISSHLQVSYLPIQEIISFTTWLLGFDLFHIVIILILAENRSCYLFMKHRVIMRRVAKRNLELF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G172260`
TK1151 ID	TkA05G172260
OH-1004 ID	LXL04_020323
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 95.420 / OH-1004 59.809 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G172260

Location Chr05:44156610-44157106 (+)

Description Similar to RR21: Two-component response regulator ORR21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59570`	Transcription factor that is a critical component of the regulatory circuit of the circadian clock.	No verified direct reference in this release
`At1g67710`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.2003 · DOI: 10.1093/pcp/pcg014
`At3g46640`	Transcription factor that is essential for the generation of the circadian clock oscillation.	PHYTOCLOCK 1 encoding a novel GARP protein essential for the Arabidopsis circadian clock.2005 · DOI: 10.1111/j.1365-2443.2005.00892.x LUX ARRHYTHMO encodes a nighttime repressor of circadian gene expression in the Arabidopsis core clock.2011 · DOI: 10.1016/j.cub.2010.12.021
`At2g40970`	Probable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway.	A single-repeat R3-MYB transcription factor MYBC1 negatively regulates freezing tolerance in Arabidopsis.2010 · DOI: 10.1016/j.bbrc.2010.03.114

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0904700`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020323 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0904700

dosa:Os02g0182100

dosa:Os03g0224200

osa:4325022

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.834

Rank 1 · TkA05G172260 · TK1151

Cytoplasm0.218

Rank 2 · TkA05G172260 · TK1151

Mitochondrion0.035

Rank 3 · TkA05G172260 · TK1151

Cell membrane0.032

Rank 4 · TkA05G172260 · TK1151

Endoplasmic reticulum0.026

Rank 5 · TkA05G172260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding28-74 aa

PF01285TEA28-45 aa

PF01285TEA65-75 aa

PF01285TEA119-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G172260	`PF00249`	Myb_DNA-binding	28	74	5.4e-07	30.3
TkA05G172260	`PF01285`	TEA	28	45	0.0049	17.9
TkA05G172260	`PF01285`	TEA	65	75	0.0049	17.9
TkA05G172260	`PF01285`	TEA	119	127	0.0049	17.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTH4`	Arabidopsis thaliana	sp\|Q9LTH4\|PCLL_ARATH Transcription factor BOA	35.400%	Swiss-Prot	Medium
`Q9FXD6`	Arabidopsis thaliana	sp\|Q9FXD6\|ARR11_ARATH Two-component response regulator ARR11	50.900%	Swiss-Prot	Low
`Q9SNB4`	Arabidopsis thaliana	sp\|Q9SNB4\|PCL1_ARATH Transcription factor LUX	44.100%	Swiss-Prot	Low
`O22210`	Arabidopsis thaliana	sp\|O22210\|MYBC1_ARATH Transcription factor MYBC1	52.100%	Swiss-Prot	Low
`Q5N6V8`	Oryza sativa subsp. japonica	sp\|Q5N6V8\|ORR26_ORYSJ Two-component response regulator ORR26	47.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card