LXL04_020323 | RubberDandelionOmics

Gene overview

LXL04_020323

Reference: OH-1004 Chr: Chr04 Coordinates: 66049403-66050144 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

640 bp · LXL04_020323|LXL04_020323|OH1004|cDNA

ATGTCCGAGGAAGATGATGATCAAACTCTACTAAATGCTTTTAAGGATGGAGCTTTACTTGTGCTCAAACGTCCATTCACTATGGATAGACTAATGTTACTACGACAACATGCCATTAGAAAGAGGATACAAAATATTAACAACTGTGATGGTAGAAATAAGTTTAGTCATGTAGAAAATTATGGTATCCTTAACCTTAAAAATATTGGTAACCATAATGTGCAAAATGAATTTCCTTGGGTTATGAAAAAAGAGCCAAT...

CDS

Download CDS FASTA

630 bp · LXL04_020323|LXL04_020323|OH1004|CDS

ATGTCCGAGGAAGATGATGATCAAACTCTACTAAATGCTTTTAAGGATGGAGCTTTACTTGTGCTCAAACGTCCATTCACTATGGATAGACTAATGTTACTACGACAACATGCCATTAGAAAGAGGATACAAAATATTAACAACTGTGATGGTAGAAATAAGTTTAGTCATGTAGAAAATTATGGTATCCTTAACCTTAAAAATATTGGTAACCATAATGTGCAAAATGAATTTCCTTGGGTTATGAAAAAAGAGCCAAT...

Protein

Download Protein FASTA

209 aa · LXL04_020323|LXL04_020323|OH1004|PROTEIN

MSEEDDDQTLLNAFKDGALLVLKRPFTMDRLMLLRQHAIRKRIQNINNCDGRNKFSHVENYGILNLKNIGNHNVQNEFPWVMKKEPIIYGGEKTTCEMIRSERNSKIRLVWTPELHAKFMNAISQLGERKCAPKLIHELMGVPGITRAQISSHLQVSYLPIQEIISFTTWLLRFDLFHIVIILTLAENRSCYLIMKHRVIMRRVAKEEP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020323`
TK1151 ID	TkA05G172260
OH-1004 ID	LXL04_020323
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 95.420 / OH-1004 59.809 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020323

Location Chr04:66049403-66050144 (-)

Description Similar to RR21: Two-component response regulator ORR21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0224200`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`UniProt: A2XE31`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os01g0904700`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os02g0182100`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`UniProt: A2X1N2`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020323 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0904700

dosa:Os02g0182100

dosa:Os03g0224200

osa:4325022

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.856

Rank 1 · LXL04_020323 · OH-1004

Cytoplasm0.188

Rank 2 · LXL04_020323 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_020323 · OH-1004

Mitochondrion0.025

Rank 4 · LXL04_020323 · OH-1004

Endoplasmic reticulum0.021

Rank 5 · LXL04_020323 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding109-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020323	`PF00249.38`	Myb_DNA-binding	109	155	3.6e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H7S7`	Oryza sativa subsp. japonica	Two-component response regulator ORR21	31.138%	Swiss-Prot	moderate database homology
`A2XE31`	Oryza sativa subsp. indica	Two-component response regulator ORR21	31.138%	Swiss-Prot	moderate database homology
`Q5N6V8`	Oryza sativa subsp. japonica	Two-component response regulator ORR26	28.743%	Swiss-Prot	weak database homology
`Q6H805`	Oryza sativa subsp. japonica	Two-component response regulator ORR24	31.481%	Swiss-Prot	moderate database homology
`A2X1N2`	Oryza sativa subsp. indica	Two-component response regulator ORR24	31.481%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card