TkA05G169860 | RubberDandelionOmics

Gene overview

TkA05G169860

Reference: TK1151 Chr: Chr05 Coordinates: 43620760-43625568 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1833 bp · TkA05G169860|TK1151|cDNA

ATGGAACAATGGTATGTGCATGCACATGCATGCATGGACATGGAAGCTTCTTGGAATGACTCTATGGGTGCTAAAACCGTCTATGACCAGCTAAGACCAAGTGGGATTGAAGATAGAATGGTTGGTATTCAGAAACCTGGTGGAGTGCTTGCTCTTCTGGATGAGGCTTGTTTTGAGCAGTTCTGCATTAATCTGACTAATGAGAAACTTCAGCAACATTTCAATCAGCATGTATTCAAGATGGAACAAGAAGAATATAC...

CDS

Download CDS FASTA

1833 bp · TkA05G169860|TK1151|CDS

ATGGAACAATGGTATGTGCATGCACATGCATGCATGGACATGGAAGCTTCTTGGAATGACTCTATGGGTGCTAAAACCGTCTATGACCAGCTAAGACCAAGTGGGATTGAAGATAGAATGGTTGGTATTCAGAAACCTGGTGGAGTGCTTGCTCTTCTGGATGAGGCTTGTTTTGAGCAGTTCTGCATTAATCTGACTAATGAGAAACTTCAGCAACATTTCAATCAGCATGTATTCAAGATGGAACAAGAAGAATATAC...

Protein

Download Protein FASTA

610 aa · TkA05G169860|TK1151|PROTEIN

MEQWYVHAHACMDMEASWNDSMGAKTVYDQLRPSGIEDRMVGIQKPGGVLALLDEACFEQFCINLTNEKLQQHFNQHVFKMEQEEYTREEIDWSYIQFEDNQDILDLIEKKPGGVLALLDEACFEQFCINLTNEKLQQHFNQHVFKMEQEEYTREEIDWSYIQFEDNQDILDLIEKKPGGVLALLDEACFEQFCINLTNEKLQQHFNQHVFNMEQEEYTREEIDWSYIQFEDNQDILDLIEKKPGGVLALLDEACMFPRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G169860`
TK1151 ID	TkA05G169860
OH-1004 ID	LXL04_006857
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 28.852 / OH-1004 32.117 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G169860

Location Chr05:43620760-43625568 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08730`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g54560`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g04600`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At2g33240`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At5g43900`	Myosin heavy chain that is required for the cell cycle- regulated transport of various organelles and proteins for their segregation.	Peroxisomal localization of a myosin XI isoform in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci085 Two class XI myosins function in organelle trafficking and root hair development in Arabidopsis.2008 · DOI: 10.1104/pp.107.113654 A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles.2009 · DOI: 10.1104/pp.109.136853 Myosin XIK is a major player in cytoplasm dynamics and is regulated by two amino acids in its tail.2012 · DOI: 10.1093/jxb/err265

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006857 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · TkA05G169860 · TK1151

Nucleus0.400

Rank 2 · TkA05G169860 · TK1151

Mitochondrion0.077

Rank 3 · TkA05G169860 · TK1151

Cell membrane0.062

Rank 4 · TkA05G169860 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA05G169860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07422s48_4541-100 aa

PF30210YKR005C_N52-92 aa

PF00063Myosin_head53-123 aa

PF04798Baculo_1955-83 aa

PF23608Ig_ILCR155-89 aa

PF16512RhoGAP-FF156-88 aa

PF24899UBA_DHX2957-76 aa

PF25945DUF798462-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G169860	`PF07422`	s48_45	41	100	0.22	12.8
TkA05G169860	`PF30210`	YKR005C_N	52	92	5.2	7.8
TkA05G169860	`PF00063`	Myosin_head	53	123	8.2e-94	315.9
TkA05G169860	`PF04798`	Baculo_19	55	83	0.0021	18.3
TkA05G169860	`PF23608`	Ig_ILCR1	55	89	0.76	10.6
TkA05G169860	`PF16512`	RhoGAP-FF1	56	88	0.087	14.1
TkA05G169860	`PF24899`	UBA_DHX29	57	76	0.00015	22.2
TkA05G169860	`PF25945`	DUF7984	62	92	0.56	10.8
TkA05G169860	`PF02815`	MIR	66	112	1.3	9.6
TkA05G169860	`PF18036`	Ubiquitin_4	67	96	0.0012	19.5
TkA05G169860	`PF07435`	YycH_N	74	105	5.1	7.8
TkA05G169860	`PF12320`	SbcD_C	81	110	7.4	7.6
TkA05G169860	`PF26066`	MCM9_N	98	134	0.0068	17.1
TkA05G169860	`PF30210`	YKR005C_N	118	158	5.2	7.8
TkA05G169860	`PF04798`	Baculo_19	121	149	0.0021	18.3
TkA05G169860	`PF07422`	s48_45	121	166	0.22	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HXP9`	Arabidopsis thaliana	sp\|F4HXP9\|MYO9_ARATH Myosin-9	64.300%	Swiss-Prot	Low
`F4HWY6`	Arabidopsis thaliana	sp\|F4HWY6\|MYO11_ARATH Myosin-11	64.300%	Swiss-Prot	Low
`F4I5Q6`	Arabidopsis thaliana	sp\|F4I5Q6\|MYO7_ARATH Myosin-7	64.800%	Swiss-Prot	Low
`F4IVR7`	Arabidopsis thaliana	sp\|F4IVR7\|MYO10_ARATH Myosin-10	65.600%	Swiss-Prot	Low
`Q9LKB9`	Arabidopsis thaliana	sp\|Q9LKB9\|MYO6_ARATH Myosin-6	65.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card