TkA05G163600 | RubberDandelionOmics

Gene overview

TkA05G163600

Reference: TK1151 Chr: Chr05 Coordinates: 42051021-42065567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1181 bp · TkA05G163600|TK1151|cDNA

AAGAATTGCAAGCATAATTTCATTTCCCTCGCCTCCCGTTCTTTCAAAAAACTCAAGAACAGGTGTAATGGAGGATTCGGCCACCATCACCGAATGTTTACTCCTCTCCGAGCTCCAATCGTCCTCGGATCTCTCCTCCATCTACCACCTTTTCTCCTCGTACCTTCACCCCTTCACCGCCATCATCAACAAACCCAAGAAACAGTCCAAACCTTCAGAAATCAATGCCAAAGCGTCAACTATTATCCACTCGCTCGCCA...

CDS

Download CDS FASTA

6186 bp · TkA05G163600|TK1151|CDS

ATGGAGGATTCGGCCACCATCACCGAATGTTTACTCCTCTCCGAGCTCCAATCGTCCTCGGATCTCTCCTCCATCTACCACCTTTTCTCCTCGTACCTTCACCCCTTCACCGCCATCATCAACAAACCCAAGAAACAGTCCAAACCTTCAGAAATCAATGCCAAAGCGTCAACTATTATCCACTCGCTCGCCAAAAAGTTCACTTCTTTCCTTAACAAAGCCCTAAATCTTATCCCCAAACGCCTGAACGAAACCCCCAA...

Protein

Download Protein FASTA

2061 aa · TkA05G163600|TK1151|PROTEIN

MEDSATITECLLLSELQSSSDLSSIYHLFSSYLHPFTAIINKPKKQSKPSEINAKASTIIHSLAKKFTSFLNKALNLIPKRLNETPKIESCYASELFEAYKLCLSCLESIMSALSCKPHYVQFQRLRLIHCYQVWGRYEDAQNEGFSLLEYIWKLWGERGGNLKREVIPQLTKENGDKDVAMLILDVVVTHCNCVLNGRSKDNEVYRRLLSMVDEVQPWWRFVEGYAYEKLHKLLVTYLTKCTLFLVGELAIFEGSLVQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G163600`
TK1151 ID	TkA05G163600
OH-1004 ID	LXL04_020300
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 78.845 / OH-1004 96.780 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G163600

Location Chr05:42051021-42065567 (+)

Description Similar to ESP1: Separase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22970`	Cleaves SYN1, releasing sister chromatid cohesion.	Arabidopsis separase AESP is essential for embryo development and the release of cohesin during meiosis.2006 · DOI: 10.1105/tpc.105.036913 A conditional mutation in Arabidopsis thaliana separase induces chromosome non-disjunction, aberrant morphogenesis and cyclin B1;1 stability.2010 · DOI: 10.1242/dev.041939 The radially swollen 4 separase mutation of Arabidopsis thaliana blocks chromosome disjunction and disrupts the radial microtubule system in meiocytes.2011 · DOI: 10.1371/journal.pone.0019459

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020300 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000086 G2/M transition of mitotic cell cycle Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006508 proteolysis Biological Process

GO:0006887 exocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0009960 endosperm development Biological Process

GO:0010389 regulation of G2/M transition of mitotic cell cycle Biological Process

KEGG gene cross-reference

ath:AT1G20930

ath:AT1G76540

ath:AT4G22970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.540

Rank 1 · TkA05G163600 · TK1151

Cytoplasm0.352

Rank 2 · TkA05G163600 · TK1151

Cell membrane0.100

Rank 3 · TkA05G163600 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA05G163600 · TK1151

Golgi apparatus0.052

Rank 5 · TkA05G163600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25110TPR_ESP111-289 aa

PF25113TPR_ESP1_2nd300-419 aa

PF25113TPR_ESP1_2nd420-450 aa

PF13374TPR_10543-560 aa

PF07719TPR_2543-562 aa

PF03568Separin_C803-849 aa

PF25110TPR_ESP1907-931 aa

PF13374TPR_10969-1002 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G163600	`PF25110`	TPR_ESP1	11	289	1e-98	330.5
TkA05G163600	`PF25113`	TPR_ESP1_2nd	300	419	4.3e-29	102.5
TkA05G163600	`PF25113`	TPR_ESP1_2nd	420	450	4.3e-29	102.5
TkA05G163600	`PF13374`	TPR_10	543	560	2.0	9.3
TkA05G163600	`PF07719`	TPR_2	543	562	8.1	7.6
TkA05G163600	`PF03568`	Separin_C	803	849	4.9e-91	306.6
TkA05G163600	`PF25110`	TPR_ESP1	907	931	1e-98	330.5
TkA05G163600	`PF13374`	TPR_10	969	1002	2.0	9.3
TkA05G163600	`PF07719`	TPR_2	969	997	8.1	7.6
TkA05G163600	`PF07719`	TPR_2	1116	1137	8.1	7.6
TkA05G163600	`PF13374`	TPR_10	1117	1137	2.0	9.3
TkA05G163600	`PF03568`	Separin_C	1542	1942	4.9e-91	306.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5IBC5`	Arabidopsis thaliana	sp\|Q5IBC5\|ESP1_ARATH Separase	37.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card