TkA05G159490 | RubberDandelionOmics

Gene overview

TkA05G159490

Reference: TK1151 Chr: Chr05 Coordinates: 41144667-41145350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · TkA05G159490|TK1151|cDNA

ATGGGTCGTGAGTGGGAACTTAGTTTCCGTCTGGGTATGCGACCTTGGATTGTTGTTGCATATTCAGCTCCTGTTGCAACTGCGACTGCTGTTTTCTTGATCTACCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATTTCTGCTGGTGTATTCGGCGGCTCCCTATTTAGTGCTATGCATGGTTCTTTGGTAACCTCTAGATTGATCAGGGAAACCACAGAAAATGAATCTGCTAATGAAGGTTACAA...

CDS

Download CDS FASTA

609 bp · TkA05G159490|TK1151|CDS

ATGGGTCGTGAGTGGGAACTTAGTTTCCGTCTGGGTATGCGACCTTGGATTGTTGTTGCATATTCAGCTCCTGTTGCAACTGCGACTGCTGTTTTCTTGATCTACCCAATTGGTCAAGGAAGCTTTTCTGATGGTATGCCTCTAGGAATTTCTGCTGGTGTATTCGGCGGCTCCCTATTTAGTGCTATGCATGGTTCTTTGGTAACCTCTAGATTGATCAGGGAAACCACAGAAAATGAATCTGCTAATGAAGGTTACAA...

Protein

Download Protein FASTA

202 aa · TkA05G159490|TK1151|PROTEIN

MGREWELSFRLGMRPWIVVAYSAPVATATAVFLIYPIGQGSFSDGMPLGISAGVFGGSLFSAMHGSLVTSRLIRETTENESANEGYKFSQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGINTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPSTNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G159490`
TK1151 ID	TkA05G159490
OH-1004 ID	LXL04_040113
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.300
Protein coverage (%)	TK1151 100.000 / OH-1004 34.977 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G159490`
Location	Chr05:41144667-41145350 (+)
Description	Similar to psbA: Photosystem II protein D1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_040113` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009635 response to herbicide Biological Process GO:0009772 photosynthetic electron transport in photosystem II Biological Process GO:0009523 photosystem II Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0005506 iron ion binding Molecular Function GO:0009055 electron transfer activity Molecular Function GO:0010242 oxygen evolving activity Molecular Function GO:0016168 chlorophyll binding Molecular Function GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor Molecular Function
KEGG gene cross-reference	nta:800514 sly:3950408 soe:2715607 sot:4099946 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.689

Rank 1 · TkA05G159490 · TK1151

Mitochondrion0.142

Rank 2 · TkA05G159490 · TK1151

Cytoplasm0.066

Rank 3 · TkA05G159490 · TK1151

Nucleus0.063

Rank 4 · TkA05G159490 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA05G159490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00124Photo_RC1-52 aa

PF00124Photo_RC52-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G159490	`PF00124`	Photo_RC	1	52	1.1e-41	143.6
TkA05G159490	`PF00124`	Photo_RC	52	176	1.1e-41	143.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card