TkA05G154780 | RubberDandelionOmics

Gene overview

TkA05G154780

Reference: TK1151 Chr: Chr05 Coordinates: 40085523-40087229 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · TkA05G154780|TK1151|cDNA

ATGATGACGAACCAACGGAGCAAACCACCACCACCGTTATCACTACCTGAGACTGAAGTGAACAATGGAGGTAGAATGAACTCGAATTCAAACCAGGATGGAACACAAACGGAAGTCCAACGTCGTCTAAAAGGACTGACGGCTGAGATGCATCTAGGTCAACTCAGAAATGGGCCTAACACAAAAACTTGGGCCAAAATTAGTATGTTGGGCTCACTTCAAACAGATCGTCCAATGGATTCTGTAAAAGCATTAACCCG...

CDS

Download CDS FASTA

1521 bp · TkA05G154780|TK1151|CDS

ATGATGACGAACCAACGGAGCAAACCACCACCACCGTTATCACTACCTGAGACTGAAGTGAACAATGGAGGTAGAATGAACTCGAATTCAAACCAGGATGGAACACAAACGGAAGTCCAACGTCGTCTAAAAGGACTGACGGCTGAGATGCATCTAGGTCAACTCAGAAATGGGCCTAACACAAAAACTTGGGCCAAAATTAGTATGTTGGGCTCACTTCAAACAGATCGTCCAATGGATTCTGTAAAAGCATTAACCCG...

Protein

Download Protein FASTA

506 aa · TkA05G154780|TK1151|PROTEIN

MMTNQRSKPPPPLSLPETEVNNGGRMNSNSNQDGTQTEVQRRLKGLTAEMHLGQLRNGPNTKTWAKISMLGSLQTDRPMDSVKALTRVQLNQRLLAHAFHPYRSPLMTYFSRVATIIFLPATALVPRASASNLLIRASPRTLAILHRLGVAVGYVVALIAPSAKDQLAHSIPQKTTMARSLKFAPTPSLLHINSHLVTRMEFSLNQKQIMHNYFLRLSQNPTQHTGDSSSSLPEFDFTSFIQDKDTKIKFTEAITKRITK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G154780`
TK1151 ID	TkA05G154780
OH-1004 ID	LXL04_016882
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	67.900
Protein coverage (%)	TK1151 92.885 / OH-1004 46.621 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G154780

Location Chr05:40085523-40087229 (-)

Description Similar to HSP81-3: Heat shock protein 81-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56030`	Molecular chaperone.	No verified direct reference in this release
`At5g56010`	Functions as a holding molecular chaperone (holdase) which stabilizes unfolding protein intermediates and rapidly releases them in an active form once stress has abated.	No verified direct reference in this release
`At5g56000`	Molecular chaperone which stabilizes unfolding protein intermediates and functions as a folding molecular chaperone that assists the non-covalent folding of proteins in an ATP-dependent manner.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YWQ1`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release
`Os08g0500700`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016882 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0051082 unfolded protein binding Molecular Function

GO:0140662 ATP-dependent protein folding chaperone Molecular Function

KEGG gene cross-reference

dosa:Os08g0500700

dosa:Os09g0482100

ini:109146489

osa:9267802

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.324

Rank 1 · TkA05G154780 · TK1151

Cytoplasm0.304

Rank 2 · TkA05G154780 · TK1151

Mitochondrion0.281

Rank 3 · TkA05G154780 · TK1151

Cell membrane0.079

Rank 4 · TkA05G154780 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA05G154780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13257DUF4048332-387 aa

PF00183HSP90358-504 aa

PF11258DUF3048402-452 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G154780	`PF13257`	DUF4048	332	387	0.13	12.8
TkA05G154780	`PF00183`	HSP90	358	504	3.4e-25	89.7
TkA05G154780	`PF11258`	DUF3048	402	452	0.28	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55737`	Arabidopsis thaliana	sp\|P55737\|HS902_ARATH Heat shock protein 90-2	53.300%	Swiss-Prot	Low
`P51818`	Arabidopsis thaliana	sp\|P51818\|HS903_ARATH Heat shock protein 90-3	53.300%	Swiss-Prot	Low
`O03986`	Arabidopsis thaliana	sp\|O03986\|HS904_ARATH Heat shock protein 90-4	52.000%	Swiss-Prot	Low
`A2YWQ1`	Oryza sativa subsp. indica	sp\|A2YWQ1\|HSP81_ORYSI Heat shock protein 81-1	50.000%	Swiss-Prot	Low
`Q0J4P2`	Oryza sativa subsp. japonica	sp\|Q0J4P2\|HSP81_ORYSJ Heat shock protein 81-1	50.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card