LXL04_016882 | RubberDandelionOmics

Gene overview

LXL04_016882

Reference: OH-1004 Chr: Chr03 Coordinates: 136059511-136062177 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2178 bp · LXL04_016882|LXL04_016882|OH1004|cDNA

ATGGAAGTCACTGATATGTTTAAGGGTCCAACCTTGGGCATATcaaatggtatcagagcagtcGGTCCTGAAGAAGGAATGTCATGGAAGAACAGATTTGACAGTGGGATGGAAGAAATGCGTCAAAATCATGCTGAGCTTCTCAAAATAATGGCGGAATCTCTTAAGAAGATGGACCGAATCTTAGAGATGGAAGGACTTCTCACACAAAGTGAAAGAGATGAGGCTAAGACTCCGAGTGAAGAAAACCCAGTGGTAAA...

CDS

Download CDS FASTA

2178 bp · LXL04_016882|LXL04_016882|OH1004|CDS

ATGGAAGTCACTGATATGTTTAAGGGTCCAACCTTGGGCATATCAAATGGTATCAGAGCAGTCGGTCCTGAAGAAGGAATGTCATGGAAGAACAGATTTGACAGTGGGATGGAAGAAATGCGTCAAAATCATGCTGAGCTTCTCAAAATAATGGCGGAATCTCTTAAGAAGATGGACCGAATCTTAGAGATGGAAGGACTTCTCACACAAAGTGAAAGAGATGAGGCTAAGACTCCGAGTGAAGAAAACCCAGTGGTAAA...

Protein

Download Protein FASTA

725 aa · LXL04_016882|LXL04_016882|OH1004|PROTEIN

MEVTDMFKGPTLGISNGIRAVGPEEGMSWKNRFDSGMEEMRQNHAELLKIMAESLKKMDRILEMEGLLTQSERDEAKTPSEENPVVNEGLEVSHSSMIEMHHQNKKKNQPSNMEQKEVNQDLSVSPGPSMAFPSVLPPRNHFSKHGEECIFCQKGRCYRFSRRAPLPPLSQPPASPPSPPMSPLSSLPPSPPFPQQPSACPPLVLNQGELHKKLEKQNLLPPKETNANGGIPVPVKASREKEMTTNQRSKPPPPPPPLSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016882`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016882

Location Chr03:136059511-136062177 (+)

Description Similar to HSP81-3: Heat shock protein 81-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q07078`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release
`Os09g0482100`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release
`Os08g0500700`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release
`UniProt: A2YWQ1`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016882 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0051082 unfolded protein binding Molecular Function

GO:0140662 ATP-dependent protein folding chaperone Molecular Function

KEGG gene cross-reference

dosa:Os08g0500700

dosa:Os09g0482100

ini:109146489

osa:9267802

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.376

Rank 1 · LXL04_016882 · OH-1004

Nucleus0.310

Rank 2 · LXL04_016882 · OH-1004

Mitochondrion0.169

Rank 3 · LXL04_016882 · OH-1004

Cell membrane0.150

Rank 4 · LXL04_016882 · OH-1004

Endoplasmic reticulum0.075

Rank 5 · LXL04_016882 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00183.24HSP90545-639 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016882	`PF00183.24`	HSP90	545	639	5.5e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q07078`	Oryza sativa subsp. japonica	Heat shock protein 81-3	36.943%	Swiss-Prot	weak database homology
`Q69QQ6`	Oryza sativa subsp. japonica	Heat shock protein 81-2	36.943%	Swiss-Prot	weak database homology
`Q0J4P2`	Oryza sativa subsp. japonica	Heat shock protein 81-1	37.762%	Swiss-Prot	weak database homology
`A2YWQ1`	Oryza sativa subsp. indica	Heat shock protein 81-1	37.762%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card