RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G153170
Reference: TK1151 Chr: Chr05 Coordinates: 39706817-39708324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

636 bp · TkA05G153170|TK1151|cDNA

CCATAACTGTAGACTGTAGTCACTTTTGACTGGATGATACTTCAAAAATAAGGCATAAGTTTGACTGTGTACAAGTTTTCTATCCTTACATATCCAGTCCCCTAGAAGCCGACACCTGCAACCTGTAGAGAGATGGATGAAAAATACGCAGAGCTGCGACAAGCGGTTCAGACGGCGGAGCTTTTTGACGCTCACGCTCACAACATCGTAGCACTTGCTTCCACCATTCCGTTCCTCAGTTGCTTCTCTGAAGCTTCCGG...

CDS

Download CDS FASTA

504 bp · TkA05G153170|TK1151|CDS

ATGGATGAAAAATACGCAGAGCTGCGACAAGCGGTTCAGACGGCGGAGCTTTTTGACGCTCACGCTCACAACATCGTAGCACTTGCTTCCACCATTCCGTTCCTCAGTTGCTTCTCTGAAGCTTCCGGCAAGGCTTTATCCTTTGTCCCATCCACCCTTAACTCAAGAGAAAGCCTAGGGGATATTGCTGAGTTATATGGGTCGGAGTTATCTATTGAAGGAATCCAAGAATATAGAAATTCCAATGGAATTGAAACAAT...

Protein

Download Protein FASTA

167 aa · TkA05G153170|TK1151|PROTEIN

MDEKYAELRQAVQTAELFDAHAHNIVALASTIPFLSCFSEASGKALSFVPSTLNSRESLGDIAELYGSELSIEGIQEYRNSNGIETISKTCFTAAGISSVLIDDGFELENMLHIEHHTNIVPFVGRILRIEHLAQQILDEGIRIGKSWTVDTFTDTFLSRLRSYPFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G153170
TK1151 IDTkA05G153170
OH-1004 IDLXL04_020230
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)94.800
Protein coverage (%)TK1151 92.216 / OH-1004 17.845
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G153170
LocationChr05:39706817-39708324 (-)
DescriptionSimilar to fluG: Protein fluG (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_020230 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001896 autolysis Biological Process
GO:0006536 glutamate metabolic process Biological Process
GO:0006542 glutamine biosynthetic process Biological Process
GO:0006598 polyamine catabolic process Biological Process
GO:0009447 putrescine catabolic process Biological Process
GO:0009636 response to toxic substance Biological Process
GO:0010913 regulation of sterigmatocystin biosynthetic process Biological Process
GO:0010914 positive regulation of sterigmatocystin biosynthetic process Biological Process
GO:0030435 sporulation resulting in formation of a cellular spore Biological Process
GO:0045461 sterigmatocystin biosynthetic process Biological Process
GO:0046203 spermidine catabolic process Biological Process
GO:0046208 spermine catabolic process Biological Process
KEGG gene cross-reference
ani:ANIA_04819
ddi:DDB_G0276835
hme:HFX_1688
mja:MJ_1346
sco:SCO6962
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.790
Rank 1 · TkA05G153170 · TK1151
Nucleus0.345
Rank 2 · TkA05G153170 · TK1151
Peroxisome0.062
Rank 3 · TkA05G153170 · TK1151
Mitochondrion0.057
Rank 4 · TkA05G153170 · TK1151
Endoplasmic reticulum0.040
Rank 5 · TkA05G153170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser