Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2592 bp · LXL04_020230|LXL04_020230|OH1004|cDNA
ATGGATGAAAAATACGCAGAGCTGCGACAAGCGGTTCAGACGGCGGAGCTTTTTGACGCTCACGCTCACAACATCGTAGCACTTGCTTCCACCATTCCGTTCCTCAGTTGCTTCTCTGAAGCTTCCGGCAAGGCTTTATCCTTTGTCCCATCCACCCTTAACTTCAAGAGAAGCCTGAGGGATATTGCTGAGTTATATGGGTCCGAGTTATCAATTGAAGGAATCCAAGAATATAGAAATTCCAATGGAATTGAAacaat...
2592 bp · LXL04_020230|LXL04_020230|OH1004|CDS
ATGGATGAAAAATACGCAGAGCTGCGACAAGCGGTTCAGACGGCGGAGCTTTTTGACGCTCACGCTCACAACATCGTAGCACTTGCTTCCACCATTCCGTTCCTCAGTTGCTTCTCTGAAGCTTCCGGCAAGGCTTTATCCTTTGTCCCATCCACCCTTAACTTCAAGAGAAGCCTGAGGGATATTGCTGAGTTATATGGGTCCGAGTTATCAATTGAAGGAATCCAAGAATATAGAAATTCCAATGGAATTGAAACAAT...
Protein
Download Protein FASTA863 aa · LXL04_020230|LXL04_020230|OH1004|PROTEIN
MDEKYAELRQAVQTAELFDAHAHNIVALASTIPFLSCFSEASGKALSFVPSTLNFKRSLRDIAELYGSELSIEGIQEYRNSNGIETISKTCFTAAGISSVLIDDGFELENMLHIEHHTNFVPFVGRILRIEHLAQQILDEGIRIGKSWTVSVVTKITNTLLIPYHYLLTFGVKVGTKDVVKVVGLKSIAAYRSGLEINPNVTTKEVEDALAQVLLGGNPVRITNKSFIDYIFVRSLEVALSFDWPMQIHTGFGDKDLDLR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_020230 |
|---|---|
| TK1151 ID | TkA05G153170 |
| OH-1004 ID | LXL04_020230 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 94.800 |
| Protein coverage (%) | TK1151 92.216 / OH-1004 17.845Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_020230 |
|---|---|
| Location | Chr04:58383608-58389159 (-) |
| Description | Similar to fluG: Protein fluG (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001896 autolysis Biological Process GO:0006536 glutamate metabolic process Biological Process GO:0006542 glutamine biosynthetic process Biological Process GO:0006598 polyamine catabolic process Biological Process GO:0009447 putrescine catabolic process Biological Process GO:0009636 response to toxic substance Biological Process GO:0010913 regulation of sterigmatocystin biosynthetic process Biological Process GO:0010914 positive regulation of sterigmatocystin biosynthetic process Biological Process GO:0030435 sporulation resulting in formation of a cellular spore Biological Process GO:0045461 sterigmatocystin biosynthetic process Biological Process GO:0046203 spermidine catabolic process Biological Process GO:0046208 spermine catabolic process Biological Process |
| KEGG gene cross-reference | ani:ANIA_04819 ddi:DDB_G0276835 hme:HFX_1688 mja:MJ_1346 sco:SCO6962 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04909.21Amidohydro_2237-395 aaPF00120.30Gln-synt_C526-855 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_020230 | PF04909.21 | Amidohydro_2 | 237 | 395 | 1.8e-11 | 45.0 |
| LXL04_020230 | PF00120.30 | Gln-synt_C | 526 | 855 | 1e-92 | 311.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.