TkA05G142320 | RubberDandelionOmics

Gene overview

TkA05G142320

Reference: TK1151 Chr: Chr05 Coordinates: 36962183-36964687 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

997 bp · TkA05G142320|TK1151|cDNA

TTGCCGGTGGAAAATTTCAAAATTCAAAGGAGATGATACCTGTGGAAAATTCAAAATTTAAATTGCCTCAGATTAAATCGACCCACACCAAACCACTGCAAATTGAACGTCGGGAGAGAGTGAGGGGACACCGGGACGAAGGCGACGGGAGCGGAGGAAGAGAGAGGGACCGCGACCAGGGGAGACCACCGACGAAACAGGGGCGCCCTTCGTCTTCTTCACAGGCGCTGCAACTCGCTGCCATCCCCGCGAGCAGGACT...

CDS

Download CDS FASTA

582 bp · TkA05G142320|TK1151|CDS

ATGGTTGCTAATGCATTCTCTAATTCTAATCGAAGGAAGGTTTTGGTTATTAATGTTTATCTTGAGTTGCTGAAAGAGAGGGAAAATAAGGAACCAAAAAACCTGCATGAAGTGATTAATCAGGGTGCTCTTGTATTTGGTGCATTAGGTAGTGGATTTGCCCAGTTTTCACAACCTGTTTTCCAGAGATGCCTAGACATTATACAAACCCAACAGCTTGCCAAGGTTGATCCAGTTACAGCTGCGGTATCAGATTGCAT...

Protein

Download Protein FASTA

193 aa · TkA05G142320|TK1151|PROTEIN

MVANAFSNSNRRKVLVINVYLELLKERENKEPKNLHEVINQGALVFGALGSGFAQFSQPVFQRCLDIIQTQQLAKVDPVTAAVSDCIIMEEKRIRDRLQLMATDIRPLMLLHNTVTQQYGSMVVEVGVWCFILWLRMRWLRLVLLKVSYGREGVLKEIYGTEMIAAWSSGWSLLRYGRTEAEKTLSAVPFMFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G142320`
TK1151 ID	TkA05G142320
OH-1004 ID	LXL04_034012
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.300
Protein coverage (%)	TK1151 94.301 / OH-1004 48.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G142320

Location Chr05:36962183-36964687 (-)

Description Similar to OsI_18044: Transportin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16950`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8ARW2`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release
`Os04g0691500`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034012 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0051170 import into nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008139 nuclear localization sequence binding Molecular Function

GO:0031267 small GTPase binding Molecular Function

GO:0061608 nuclear import signal receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G16950

dosa:Os04g0691500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.417

Rank 1 · TkA05G142320 · TK1151

Nucleus0.416

Rank 2 · TkA05G142320 · TK1151

Mitochondrion0.137

Rank 3 · TkA05G142320 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA05G142320 · TK1151

Cell membrane0.069

Rank 5 · TkA05G142320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04949Transcrip_act3-38 aa

PF17031DUF510121-40 aa

PF17031DUF510162-103 aa

PF04949Transcrip_act69-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G142320	`PF04949`	Transcrip_act	3	38	0.12	13.0
TkA05G142320	`PF17031`	DUF5101	21	40	0.12	13.3
TkA05G142320	`PF17031`	DUF5101	62	103	0.12	13.3
TkA05G142320	`PF04949`	Transcrip_act	69	109	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0U4`	Arabidopsis thaliana	sp\|Q8H0U4\|TNPO1_ARATH Transportin-1	46.400%	Swiss-Prot	Low
`B8ARW2`	Oryza sativa subsp. indica	sp\|B8ARW2\|TNPO1_ORYSI Transportin-1	51.000%	Swiss-Prot	Low
`B9FDR3`	Oryza sativa subsp. japonica	sp\|B9FDR3\|TNPO1_ORYSJ Transportin-1	51.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card