LXL04_034012 | RubberDandelionOmics

Gene overview

LXL04_034012

Reference: OH-1004 Chr: Chr07 Coordinates: 74464394-74471526 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_034012|LXL04_034012|OH1004|cDNA

ATGGTTGCTAATGCATTCTCTAATTCTAATCGAAGGAAGGTTTTgGTTATTAATGTTTATCTTGAGTTGCTGAAAGAGAGGGAAAATAAGGAACCAAAAAACCTGCATGAAGTGATTAATCAGGGTGCTCTTGCATTAGGTAGTGGATTTTCCCAGTTTTCACAACCTGTTTTCCAGAGATGCCTAGACATTATACAAACCCAACAGCTTGCCAAGGTTGATCCAGTTACAGCTGCGGTATCAGATTGCATCATCATGGA...

CDS

Download CDS FASTA

1119 bp · LXL04_034012|LXL04_034012|OH1004|CDS

ATGGTTGCTAATGCATTCTCTAATTCTAATCGAAGGAAGGTTTTGGTTATTAATGTTTATCTTGAGTTGCTGAAAGAGAGGGAAAATAAGGAACCAAAAAACCTGCATGAAGTGATTAATCAGGGTGCTCTTGCATTAGGTAGTGGATTTTCCCAGTTTTCACAACCTGTTTTCCAGAGATGCCTAGACATTATACAAACCCAACAGCTTGCCAAGGTTGATCCAGTTACAGCTGCGGTATCAGATTGCATCATCATGGA...

Protein

Download Protein FASTA

372 aa · LXL04_034012|LXL04_034012|OH1004|PROTEIN

MVANAFSNSNRRKVLVINVYLELLKERENKEPKNLHEVINQGALALGSGFSQFSQPVFQRCLDIIQTQQLAKVDPVTAAVSDCIIMEEKRIRDRLQLMAADIRPLMLLHNTVTQQYGSMVVEVGVWCFILWLRMRWLRLVLLKVSYGREGVLKEIYGTEMIAAWSSGWSLLRYGRTEAELSQQVQAGMENMLKMITEIDQSSSGIIEEIEKCKYSAFERKRSLEEDKDEEVDKVLTSLAGETAAQLPEAVDKWWGYYFQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034012`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034012

Location Chr07:74464394-74471526 (-)

Description Similar to OsI_18044: Transportin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16950`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8ARW2`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release
`Os04g0691500`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034012 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0051170 import into nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008139 nuclear localization sequence binding Molecular Function

GO:0031267 small GTPase binding Molecular Function

GO:0061608 nuclear import signal receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G16950

dosa:Os04g0691500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.382

Rank 1 · LXL04_034012 · OH-1004

Cytoplasm0.375

Rank 2 · LXL04_034012 · OH-1004

Mitochondrion0.166

Rank 3 · LXL04_034012 · OH-1004

Cell membrane0.110

Rank 4 · LXL04_034012 · OH-1004

Endoplasmic reticulum0.088

Rank 5 · LXL04_034012 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0U4`	Arabidopsis thaliana	Transportin-1	71.429%	Swiss-Prot	weak database homology
`B8ARW2`	Oryza sativa subsp. indica	Transportin-1	60.000%	Swiss-Prot	weak database homology
`B9FDR3`	Oryza sativa subsp. japonica	Transportin-1	60.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card