RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G135930
Reference: TK1151 Chr: Chr05 Coordinates: 35500991-35503215 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2146 bp · TkA05G135930|TK1151|cDNA

CAAAAAAATGAATATAATTTTGTTGAAAAACAAACCTCATCCCTATCCACTTGCAGCTTCAGTTCATATCTAGCAAAGAATGATGGGCACAAAAAGCAGTACCTAAAAATGGCTGTTTGCTTCTCCACCACCACCATCAACGACCTTCCCGACGTCATACTTTCCAACATAATCGCCGCCGTCTCTGACGTCCGCGCCCGCAACGCTGCTTCCTTAGTCTCCCGGAAATGGCTCCTATTAGACCGATCAACCCGCACCTC...

CDS

Download CDS FASTA

1302 bp · TkA05G135930|TK1151|CDS

CAAAAAAATGAATATAATTTTGTTGAAAAACAAACCTCATCCCTATCCACTTGCAGCTTCAGTTCATATCTAGCAAAGAATGATGGGCACAAAAAGCAGTACCTAAAAATGGCTGTTTGCTTCTCCACCACCACCATCAACGACCTTCCCGACGTCATACTTTCCAACATAATCGCCGCCGTCTCTGACGTCCGCGCCCGCAACGCTGCTTCCTTAGTCTCCCGGAAATGGCTCCTATTAGACCGATCAACCCGCACCTC...

Protein

Download Protein FASTA

433 aa · TkA05G135930|TK1151|PROTEIN

QKNEYNFVEKQTSSLSTCSFSSYLAKNDGHKKQYLKMAVCFSTTTINDLPDVILSNIIAAVSDVRARNAASLVSRKWLLLDRSTRTSLTLRGNARDLFMLPSCFRSVTHLDLSLLSPWGHPLLSSTDAAYPALFAQHLRQSFPNVKSLIIYSRNPSALQLLAPQWPSLSQIKLVRWHQRPPQPPPGADILPIFENCRDIKSLDLSNFYCWTDDIPPALKTHPQIAAKLTFLNLLNPSLPEGFKAQEVEEISKACPNLKKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G135930
TK1151 IDTkA05G135930
OH-1004 IDLXL04_020102
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.800
Protein coverage (%)TK1151 97.229 / OH-1004 45.415
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G135930
LocationChr05:35500991-35503215 (+)
DescriptionSimilar to MAX2A: F-box/LRR-repeat MAX2 homolog A
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g42620 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
ORE9, an F-box protein that regulates leaf senescence in Arabidopsis.2001 · DOI: 10.1105/tpc.010061
MAX1 and MAX2 control shoot lateral branching in Arabidopsis.2002 · DOI: 10.1242/dev.129.5.1131
MAX1 encodes a cytochrome P450 family member that acts downstream of MAX3/4 to produce a carotenoid-derived branch-inhibiting hormone.2005 · DOI: 10.1016/j.devcel.2005.01.009
MAX2 participates in an SCF complex which acts locally at the node to suppress shoot branching.2007 · DOI: 10.1111/j.1365-313x.2007.03032.x
Specialisation within the DWARF14 protein family confers distinct responses to karrikins and strigolactones in Arabidopsis.2012 · DOI: 10.1242/dev.074567
Mitogen-activated protein kinase 6 mediates nuclear translocation of ORE3 to promote ORE9 gene expression in methyl jasmonate-induced leaf senescence.2016 · DOI: 10.1093/jxb/erv438

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0154200 Involved in strigolactone (SL) signaling. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_020102 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0010016 shoot system morphogenesis Biological Process
GO:0010187 negative regulation of seed germination Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process
GO:0061137 bud dilation Biological Process
GO:0160062 cutin-based cuticle development Biological Process
KEGG gene cross-reference
ath:AT2G42620
dosa:Os06g0154200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.735
Rank 1 · TkA05G135930 · TK1151
Cytoplasm0.267
Rank 2 · TkA05G135930 · TK1151
Cell membrane0.049
Rank 3 · TkA05G135930 · TK1151
Endoplasmic reticulum0.043
Rank 4 · TkA05G135930 · TK1151
Plastid0.030
Rank 5 · TkA05G135930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like46-77 aa
PF18511F-box_549-86 aa
PF12799LRR_4106-112 aa
PF12799LRR_4141-154 aa
PF12799LRR_4190-207 aa
PF25372LRR_FBXL15192-238 aa
PF12799LRR_4227-233 aa
PF12799LRR_4247-259 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G135930PF12937F-box-like46770.01715.6
TkA05G135930PF18511F-box_549865.1e-0833.0
TkA05G135930PF12799LRR_41061120.07414.1
TkA05G135930PF12799LRR_41411540.07414.1
TkA05G135930PF12799LRR_41902070.07414.1
TkA05G135930PF25372LRR_FBXL151922380.001317.9
TkA05G135930PF12799LRR_42272330.07414.1
TkA05G135930PF12799LRR_42472590.07414.1
TkA05G135930PF12799LRR_42812940.07414.1
TkA05G135930PF12937F-box-like2933030.01715.6
TkA05G135930PF12799LRR_43343690.07414.1
TkA05G135930PF25372LRR_FBXL153564280.001317.9
TkA05G135930PF23247LRR_RPS23574250.2312.1
TkA05G135930PF12799LRR_43804020.07414.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SIM9Arabidopsis thalianasp|Q9SIM9|MAX2_ARATH F-box protein MAX257.400%Swiss-ProtHigh
Q5VMP0Oryza sativa subsp. japonicasp|Q5VMP0|MAX2_ORYSJ F-box/LRR-repeat MAX2 homolog41.900%Swiss-ProtMedium

JBrowse

View in Genome Browser