LXL04_020102 | RubberDandelionOmics

Gene overview

LXL04_020102

Reference: OH-1004 Chr: Chr04 Coordinates: 51701414-51705737 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2784 bp · LXL04_020102|LXL04_020102|OH1004|cDNA

ATGTTTAAAGTTGAAGGCGAAGATAATTCTGAAGATGTCGATGAATGGCGAAGGTCTGAAGAAACTAAGGTGGTGTTTGTTTTTAGGTTAGAAGTGCTTCTAGCCACTTCTGTCTGCGCCACGCAGATGGCGTGCAGACGTAGAGGTGTCGCAGATCGCGCAGATAATGAAACGTCTGCGCGCCCTCTTCTTGGTGCAGATCCGGACCCAATATCTTCAAACCTCTTCTCACTTCCTAAACCTAGAAAATGCTGGCCGCA...

CDS

Download CDS FASTA

2784 bp · LXL04_020102|LXL04_020102|OH1004|CDS

ATGTTTAAAGTTGAAGGCGAAGATAATTCTGAAGATGTCGATGAATGGCGAAGGTCTGAAGAAACTAAGGTGGTGTTTGTTTTTAGGTTAGAAGTGCTTCTAGCCACTTCTGTCTGCGCCACGCAGATGGCGTGCAGACGTAGAGGTGTCGCAGATCGCGCAGATAATGAAACGTCTGCGCGCCCTCTTCTTGGTGCAGATCCGGACCCAATATCTTCAAACCTCTTCTCACTTCCTAAACCTAGAAAATGCTGGCCGCA...

Protein

Download Protein FASTA

927 aa · LXL04_020102|LXL04_020102|OH1004|PROTEIN

MFKVEGEDNSEDVDEWRRSEETKVVFVFRLEVLLATSVCATQMACRRRGVADRADNETSARPLLGADPDPISSNLFSLPKPRKCWPQKMKLSPSRFSPIKRCSSPIFLHHRSLLIAGSSATLLAGLQPRYSPAYLVRFLPFKPPISAADFTRFLHLQSLEVYGSSIGFPGENRHYVWDPEIEAKLVPHSAFEFVDSCQNVNLQMLKKTNSLFAADCRQKQTSSLSTCSFSSYLAKNDGHKKQYLKMAVCFSTTTINDLPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020102`
TK1151 ID	TkA05G135930
OH-1004 ID	LXL04_020102
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 97.229 / OH-1004 45.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020102

Location Chr04:51701414-51705737 (+)

Description Similar to MAX2A: F-box/LRR-repeat MAX2 homolog A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42620`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	ORE9, an F-box protein that regulates leaf senescence in Arabidopsis.2001 · DOI: 10.1105/tpc.010061 MAX1 and MAX2 control shoot lateral branching in Arabidopsis.2002 · DOI: 10.1242/dev.129.5.1131 MAX1 encodes a cytochrome P450 family member that acts downstream of MAX3/4 to produce a carotenoid-derived branch-inhibiting hormone.2005 · DOI: 10.1016/j.devcel.2005.01.009 MAX2 participates in an SCF complex which acts locally at the node to suppress shoot branching.2007 · DOI: 10.1111/j.1365-313x.2007.03032.x Specialisation within the DWARF14 protein family confers distinct responses to karrikins and strigolactones in Arabidopsis.2012 · DOI: 10.1242/dev.074567 Mitogen-activated protein kinase 6 mediates nuclear translocation of ORE3 to promote ORE9 gene expression in methyl jasmonate-induced leaf senescence.2016 · DOI: 10.1093/jxb/erv438

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0154200`	Involved in strigolactone (SL) signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020102 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0061137 bud dilation Biological Process

GO:0160062 cutin-based cuticle development Biological Process

KEGG gene cross-reference

ath:AT2G42620

dosa:Os06g0154200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · LXL04_020102 · OH-1004

Cytoplasm0.210

Rank 2 · LXL04_020102 · OH-1004

Cell membrane0.067

Rank 3 · LXL04_020102 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_020102 · OH-1004

Plastid0.029

Rank 5 · LXL04_020102 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18511.7F-box_5258-295 aa

PF25372.2LRR_FBXL15565-663 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020102	`PF18511.7`	F-box_5	258	295	9.8e-08	32.1
LXL04_020102	`PF25372.2`	LRR_FBXL15	565	663	1.7e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIM9`	Arabidopsis thaliana	F-box protein MAX2	59.626%	Swiss-Prot	strong database homology
`Q5VMP0`	Oryza sativa subsp. japonica	F-box/LRR-repeat MAX2 homolog	46.133%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card