TkA05G133660 | RubberDandelionOmics

Gene overview

TkA05G133660

Reference: TK1151 Chr: Chr05 Coordinates: 34992872-34995165 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · TkA05G133660|TK1151|cDNA

CACAACACATGTGTGATTCATTCCAAAAAAACATCCTTAAATCCCATACTTCTTTCTTCCACTTTATACAGTTTTGAAATTCATTTCTGGTACCTCGTAAAAGTACAACATCATGAGTGGAGGTGGTTTCTCCTCAAAATGGCGAAAACTAAGCGGAGAAGACAAATGGAATTCACTCTTGGAACCTCTCGACCTCGACCTAAGACGTTACCTCATGTTTTATGGTGAAAGGATTCAAGCCACCTACGACACTTTCATTC...

CDS

Download CDS FASTA

1323 bp · TkA05G133660|TK1151|CDS

ATGAGTGGAGGTGGTTTCTCCTCAAAATGGCGAAAACTAAGCGGAGAAGACAAATGGAATTCACTCTTGGAACCTCTCGACCTCGACCTAAGACGTTACCTCATGTTTTATGGTGAAAGGATTCAAGCCACCTACGACACTTTCATTCTTGATCGTAGGTCAAAATACACGGGTGCAAGCAAATTCTCGCAAAGGAAATTCTTTTCACACCTAGGTCTCGATAAGGGCAACCCTATAAAATACAACGTCGTTAAGTTTAT...

Protein

Download Protein FASTA

440 aa · TkA05G133660|TK1151|PROTEIN

MSGGGFSSKWRKLSGEDKWNSLLEPLDLDLRRYLMFYGERIQATYDTFILDRRSKYTGASKFSQRKFFSHLGLDKGNPIKYNVVKFIYATSMTPDAPLSFLLKSIAKDPWLGQSNWMGYVAVSSHKSKGLLGRRDILVSWRGTIQISEWIENFDFPLTLASNVFPTSNCALVHAGFLSIYTSSNPNSRFNKTSARHQVLSTIKRLVEKYKDEDTSITVIGHSLGGALATLTGGDIAVNGYNKLTSQPTKSIPVTVFAFGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G133660`
TK1151 ID	TkA05G133660
OH-1004 ID	LXL04_020082
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G133660

Location Chr05:34992872-34995165 (+)

Description Similar to DSEL: Phospholipase A1-IIgamma

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18550`	Acylhydrolase that catalyzes the hydrolysis of 1,3- diacylglycerol (1,3-DAG) and 1-monoacylglycerol (1-MAG) at the sn-1 position.	AtDSEL, an Arabidopsis cytosolic DAD1-like acylhydrolase, is involved in negative regulation of storage oil mobilization during seedling establishment.2011 · DOI: 10.1016/j.jplph.2011.03.004
`At2g31100`	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	No verified direct reference in this release
`At1g06250`	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WT95`	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	No verified direct reference in this release
`Os01g0651100`	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020082 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010187 negative regulation of seed germination Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019915 lipid storage Biological Process

GO:0046340 diacylglycerol catabolic process Biological Process

GO:0052651 monoacylglycerol catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function

GO:0047372 monoacylglycerol lipase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06250

ath:AT2G31100

ath:AT4G18550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · TkA05G133660 · TK1151

Lysosome / Vacuole0.195

Rank 2 · TkA05G133660 · TK1151

Nucleus0.135

Rank 3 · TkA05G133660 · TK1151

Endoplasmic reticulum0.104

Rank 4 · TkA05G133660 · TK1151

Plastid0.097

Rank 5 · TkA05G133660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26363Phospholipase-like131-162 aa

PF01764Lipase_3138-295 aa

PF05728UPF0227194-230 aa

PF20408Abhydrolase_11195-240 aa

PF05057DUF676196-267 aa

PF07819PGAP1197-230 aa

PF12697Abhydrolase_6198-239 aa

PF20434BD-FAE202-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G133660	`PF26363`	Phospholipase-like	131	162	0.0011	19.0
TkA05G133660	`PF01764`	Lipase_3	138	295	1.2e-32	113.5
TkA05G133660	`PF05728`	UPF0227	194	230	0.068	13.8
TkA05G133660	`PF20408`	Abhydrolase_11	195	240	0.27	11.6
TkA05G133660	`PF05057`	DUF676	196	267	0.00041	20.7
TkA05G133660	`PF07819`	PGAP1	197	230	0.00048	20.7
TkA05G133660	`PF12697`	Abhydrolase_6	198	239	0.0088	17.4
TkA05G133660	`PF20434`	BD-FAE	202	234	0.1	12.8
TkA05G133660	`PF26363`	Phospholipase-like	207	230	0.0011	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49523`	Arabidopsis thaliana	sp\|O49523\|DSEL_ARATH Phospholipase A1-IIgamma	48.600%	Swiss-Prot	Medium
`O82274`	Arabidopsis thaliana	sp\|O82274\|PLA19_ARATH Phospholipase A1-IIbeta	47.700%	Swiss-Prot	Medium
`Q9LNC2`	Arabidopsis thaliana	sp\|Q9LNC2\|PLA18_ARATH Phospholipase A1-IIalpha	43.800%	Swiss-Prot	Medium
`A2WT95`	Oryza sativa subsp. indica	sp\|A2WT95\|PLA1_ORYSI Phospholipase A1-II 1	46.000%	Swiss-Prot	Medium
`A2ZW16`	Oryza sativa subsp. japonica	sp\|A2ZW16\|PLA1_ORYSJ Phospholipase A1-II 1	46.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card