TkA05G100590 | RubberDandelionOmics

Gene overview

TkA05G100590

Reference: TK1151 Chr: Chr05 Coordinates: 27061248-27064350 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · TkA05G100590|TK1151|cDNA

CCCTCCCAAAGAAAAGTCTATGAAAGCATGAGTTATTACCTTGCTGGTACAATATGGTTGATTTATAATACTACTATTTTTTCAAATTTAAACAAATCCCAAAAACCAAATCTGACCATCGGAAAACATACTTCACTTACGTACGCCGCCCCACTATCATGACAGATTCTCTGAATGTAGCCGTTATCGGAGCCGGCACATCCGGATTACTCACCGCCCGGGAGCTTATCCGTGAACACCACCGAGTTACCGTCTTCGAA...

CDS

Download CDS FASTA

672 bp · TkA05G100590|TK1151|CDS

ATGATTGGGAATGGGCCAAGTGCGCTCGATATATCTCAAGAAATTGCAACAGTTGCTAAAGAGGTTCATCTTTCATCAAGATCTACAAATGTCAAGGTCACTATGCTAGATGGGTACAAAAATATGTGGCAACATTCCAAGATTAATCGTGTTTATGATGATGGAAGGGTTGTGTTCCAAGATGGATATTCTATCGAAGCAAATGTTATCTTACACTGCACTGGGTACAAATTCCATTTCCCATTTCTAAAAATGAACAA...

Protein

Download Protein FASTA

223 aa · TkA05G100590|TK1151|PROTEIN

MIGNGPSALDISQEIATVAKEVHLSSRSTNVKVTMLDGYKNMWQHSKINRVYDDGRVVFQDGYSIEANVILHCTGYKFHFPFLKMNNIVHADDNRVGPLYKHVFPPLLAPRLAFVGLTYNQGVLFRMFELQSKWVALVLSGKLLLPSEDEMLADVYKHYQEMEENGIPKWHTHSLAFKSEYVDWLAAQVGLEIEDRLKEIFGKLFAYYVSHPNRNGFRDLFQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G100590`
TK1151 ID	TkA05G100590
OH-1004 ID	LXL04_019883
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 21.525 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G100590

Location Chr05:27061248-27064350 (-)

Description Similar to PLT4: Probable polyol transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62620`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g63370`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g12200`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g12140`	Catalyzes the conversion of methylthioalkyl glucosinolates into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g62600`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019883 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010311 lateral root formation Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0004499 N,N-dimethylaniline monooxygenase activity Molecular Function

GO:0005351 carbohydrate:proton symporter activity Molecular Function

GO:0005354 galactose transmembrane transporter activity Molecular Function

GO:0005365 myo-inositol transmembrane transporter activity Molecular Function

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G62560

ath:AT2G16120

ath:AT2G16130

ath:AT2G20780

ath:AT3G18830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.716

Rank 1 · TkA05G100590 · TK1151

Nucleus0.370

Rank 2 · TkA05G100590 · TK1151

Endoplasmic reticulum0.048

Rank 3 · TkA05G100590 · TK1151

Mitochondrion0.042

Rank 4 · TkA05G100590 · TK1151

Cell membrane0.032

Rank 5 · TkA05G100590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00743FMO-like1-29 aa

PF00070Pyr_redox2-37 aa

PF07992Pyr_redox_22-77 aa

PF13738Pyr_redox_34-94 aa

PF00743FMO-like54-185 aa

PF07992Pyr_redox_2135-167 aa

PF00070Pyr_redox136-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G100590	`PF00743`	FMO-like	1	29	2.8e-23	82.9
TkA05G100590	`PF00070`	Pyr_redox	2	37	0.04	15.1
TkA05G100590	`PF07992`	Pyr_redox_2	2	77	0.26	11.4
TkA05G100590	`PF13738`	Pyr_redox_3	4	94	0.026	14.5
TkA05G100590	`PF00743`	FMO-like	54	185	2.8e-23	82.9
TkA05G100590	`PF07992`	Pyr_redox_2	135	167	0.26	11.4
TkA05G100590	`PF00070`	Pyr_redox	136	168	0.04	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXD5`	Arabidopsis thaliana	sp\|Q9SXD5\|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3	52.400%	Swiss-Prot	High
`Q9C8U0`	Arabidopsis thaliana	sp\|Q9C8U0\|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5	52.400%	Swiss-Prot	High
`Q9FWW9`	Arabidopsis thaliana	sp\|Q9FWW9\|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2	55.500%	Swiss-Prot	High
`A8MRX0`	Arabidopsis thaliana	sp\|A8MRX0\|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5	48.400%	Swiss-Prot	Medium
`Q94BV5`	Arabidopsis thaliana	sp\|Q94BV5\|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card