TkA05G094100 | RubberDandelionOmics

Gene overview

TkA05G094100

Reference: TK1151 Chr: Chr05 Coordinates: 25386851-25387249 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA05G094100|TK1151|cDNA

ATGGGTGAAGGTGAAGAAATTCCCGCAGAAACCGTTCAATCGAGCTTACCTGCCGGCAGAGTGAAACGGATTATTAAACTCGACAAAGAAATCAATAAAATCAACGCCGATGCCCTATTCGTAATCTCTAACGCCACCGAGCTCTTCGTCAAGTTATTGGCTGAGAAATCATCAGAGGTCGCAGTTGAGAAGAAAAGGAAGACGATAAATCTGGAGCACCTCAGAATAGCCGTTAAGAGACACCAGCCCACTGCTGCTTT...

CDS

Download CDS FASTA

399 bp · TkA05G094100|TK1151|CDS

ATGGGTGAAGGTGAAGAAATTCCCGCAGAAACCGTTCAATCGAGCTTACCTGCCGGCAGAGTGAAACGGATTATTAAACTCGACAAAGAAATCAATAAAATCAACGCCGATGCCCTATTCGTAATCTCTAACGCCACCGAGCTCTTCGTCAAGTTATTGGCTGAGAAATCATCAGAGGTCGCAGTTGAGAAGAAAAGGAAGACGATAAATCTGGAGCACCTCAGAATAGCCGTTAAGAGACACCAGCCCACTGCTGCTTT...

Protein

Download Protein FASTA

132 aa · TkA05G094100|TK1151|PROTEIN

MGEGEEIPAETVQSSLPAGRVKRIIKLDKEINKINADALFVISNATELFVKLLAEKSSEVAVEKKRKTINLEHLRIAVKRHQPTAAFLLDSLPMLAPAVQTSSKPDRPPKSSDKNSVPVGSRRIDSFFQKGP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G094100`
TK1151 ID	TkA05G094100
OH-1004 ID	LXL04_019842
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.970 / OH-1004 61.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G094100`
Location	Chr05:25386851-25387249 (+)
Description	Similar to POLE4: DNA polymerase epsilon subunit 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019842` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0009408 response to heat Biological Process GO:0009414 response to water deprivation Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0008622 epsilon DNA polymerase complex Cellular Component GO:0017054 negative cofactor 2 complex Cellular Component GO:0090575 RNA polymerase II transcription regulator complex Cellular Component
KEGG gene cross-reference	ath:AT1G07980 bta:540345 hsa:56655 mmu:66556 rno:293674 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA05G094100 · TK1151

Cytoplasm0.143

Rank 2 · TkA05G094100 · TK1151

Mitochondrion0.015

Rank 3 · TkA05G094100 · TK1151

Cell membrane0.014

Rank 4 · TkA05G094100 · TK1151

Extracellular0.008

Rank 5 · TkA05G094100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15510CENP-W12-79 aa

PF00125Histone13-79 aa

PF04719TAFII2813-80 aa

PF15511CENP-T_C14-81 aa

PF00808CBFD_NFYB_HMF15-78 aa

PF10035DUF217922-48 aa

PF10035DUF217971-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G094100	`PF15510`	CENP-W	12	79	0.0065	17.4
TkA05G094100	`PF00125`	Histone	13	79	5.3e-07	30.6
TkA05G094100	`PF04719`	TAFII28	13	80	0.047	14.4
TkA05G094100	`PF15511`	CENP-T_C	14	81	0.0051	17.6
TkA05G094100	`PF00808`	CBFD_NFYB_HMF	15	78	3.6e-20	72.7
TkA05G094100	`PF10035`	DUF2179	22	48	0.13	12.8
TkA05G094100	`PF10035`	DUF2179	71	85	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card