LXL04_019842 | RubberDandelionOmics

Gene overview

LXL04_019842

Reference: OH-1004 Chr: Chr04 Coordinates: 41594118-41599651 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · LXL04_019842|LXL04_019842|OH1004|cDNA

atgaaaatgcaggattttcacaaaacaaactcttatgaactcaccaaccttttggttgacactttcaaaactcatgcaatctcaaAAGATAACAACATGGTTACTAATGAGAATGGTGGAGAGCATGAAGAATCCGTAATTCTCAATAAGATGGAAGAAGATGATTTGAGGGACGACTCACACACTGAGTCCCACATGGAGGAGGATGCAAAGCCCCAGGCAGTGCACTCTGATCCACAATGTGAAGAAATTCCCGCAGA...

CDS

Download CDS FASTA

630 bp · LXL04_019842|LXL04_019842|OH1004|CDS

ATGAAAATGCAGGATTTTCACAAAACAAACTCTTATGAACTCACCAACCTTTTGGTTGACACTTTCAAAACTCATGCAATCTCAAAAGATAACAACATGGTTACTAATGAGAATGGTGGAGAGCATGAAGAATCCGTAATTCTCAATAAGATGGAAGAAGATGATTTGAGGGACGACTCACACACTGAGTCCCACATGGAGGAGGATGCAAAGCCCCAGGCAGTGCACTCTGATCCACAATGTGAAGAAATTCCCGCAGA...

Protein

Download Protein FASTA

209 aa · LXL04_019842|LXL04_019842|OH1004|PROTEIN

MKMQDFHKTNSYELTNLLVDTFKTHAISKDNNMVTNENGGEHEESVILNKMEEDDLRDDSHTESHMEEDAKPQAVHSDPQCEEIPAETVQSSLPAGRVKRIIKLDKEINKINADALFVISNATELFVKLLAEKSSEVAVEKKRKTINLEHLRIAVKRHQPTAAFLLDSLPMLAPAVQTSSKPDRPPKSSDKNSVPVGSRRIDSFFQKGP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019842`
TK1151 ID	TkA05G094100
OH-1004 ID	LXL04_019842
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.970 / OH-1004 61.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019842

Location Chr04:41594118-41599651 (-)

Description Similar to POLE4: DNA polymerase epsilon subunit 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07980`	Transcription factor which promotes the expression of heat stress-inducible genes by contributing to the formation of a heat stress-specific transcriptional complex with NF-Y subunits (e.g. NF-YA2 and NF-YB3) and DREB2A at the promoter of target genes, thus promoting heat tolerance.	Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.2014 · DOI: 10.1105/tpc.114.132928 Nuclear moonlighting of cytosolic glyceraldehyde-3-phosphate dehydrogenase regulates Arabidopsis response to heat stress.2020 · DOI: 10.1038/s41467-020-17311-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019842 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0008622 epsilon DNA polymerase complex Cellular Component

GO:0017054 negative cofactor 2 complex Cellular Component

GO:0090575 RNA polymerase II transcription regulator complex Cellular Component

KEGG gene cross-reference

ath:AT1G07980

bta:540345

hsa:56655

mmu:66556

rno:293674

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · LXL04_019842 · OH-1004

Cytoplasm0.171

Rank 2 · LXL04_019842 · OH-1004

Mitochondrion0.020

Rank 3 · LXL04_019842 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_019842 · OH-1004

Golgi apparatus0.008

Rank 5 · LXL04_019842 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone83-156 aa

PF00808.30CBFD_NFYB_HMF92-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019842	`PF00125.31`	Histone	83	156	7.7e-07	30.1
LXL04_019842	`PF00808.30`	CBFD_NFYB_HMF	92	155	8.4e-20	71.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN09`	Arabidopsis thaliana	DNA polymerase II subunit B3-1	34.118%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card