TkA05G088310 | RubberDandelionOmics

Gene overview

TkA05G088310

Reference: TK1151 Chr: Chr05 Coordinates: 23856167-23857786 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1590 bp · TkA05G088310|TK1151|cDNA

ATGAAGAAATCTCAAGGATGCTCTTTTGTCTTCCTCTTAGTTTTAACTCTATCTTTTTCTATTTCATATGGAACTATTTCTTCCATTTTCGATGTTACACCAAATTTTAGAGAGACGATGATAAGTTGCATACTATCCAACTCGAACAATGTCACTGCCATTTCTCAAGTCATTTTCACCCCTTTCAATAGCTCTTTCTTACCCATTTGGCAAGCCGCGGTCCAAAACACTAGATTCCTTAAACCCTCCACTCCTAAACC...

CDS

Download CDS FASTA

1590 bp · TkA05G088310|TK1151|CDS

ATGAAGAAATCTCAAGGATGCTCTTTTGTCTTCCTCTTAGTTTTAACTCTATCTTTTTCTATTTCATATGGAACTATTTCTTCCATTTTCGATGTTACACCAAATTTTAGAGAGACGATGATAAGTTGCATACTATCCAACTCGAACAATGTCACTGCCATTTCTCAAGTCATTTTCACCCCTTTCAATAGCTCTTTCTTACCCATTTGGCAAGCCGCGGTCCAAAACACTAGATTCCTTAAACCCTCCACTCCTAAACC...

Protein

Download Protein FASTA

529 aa · TkA05G088310|TK1151|PROTEIN

MKKSQGCSFVFLLVLTLSFSISYGTISSIFDVTPNFRETMISCILSNSNNVTAISQVIFTPFNSSFLPIWQAAVQNTRFLKPSTPKPSIIMTPAEEKHIQTSLYCAKKHGYEIRIRSGGHDFEGLSYTADIPFLMLDFTNMRSIEVDIAYRLAWVQESATMGELYYSISLKTDTLYFPGGNCPTVGFGGFIGGGGYGILIRKYGLGADNVVDVRFMDVSGNILNRKSMGEDLFWAIRGGGASSFGIVIAWKLRLVPVPER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G088310`
TK1151 ID	TkA05G088310
OH-1004 ID	LXL04_025687
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 100.000 / OH-1004 37.941 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G088310`
Location	Chr05:23856167-23857786 (+)
Description	Similar to At5g44440: Berberine bridge enzyme-like 28
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025687` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009651 response to salt stress Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:1901696 cannabinoid biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0048046 apoplast Cellular Component GO:0016491 oxidoreductase activity Molecular Function GO:0050328 tetrahydroberberine oxidase activity Molecular Function GO:0071949 FAD binding Molecular Function GO:0102778 delta9-tetrahydrocannabinolate synthase activity Molecular Function
KEGG gene cross-reference	ag:ADY15026 ag:BAC41356 ath:AT5G44440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.523

Rank 1 · TkA05G088310 · TK1151

Lysosome / Vacuole0.125

Rank 2 · TkA05G088310 · TK1151

Endoplasmic reticulum0.119

Rank 3 · TkA05G088310 · TK1151

Cytoplasm0.111

Rank 4 · TkA05G088310 · TK1151

Cell membrane0.086

Rank 5 · TkA05G088310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565FAD_binding_487-223 aa

PF17620ORF45281-343 aa

PF08031BBE472-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G088310	`PF01565`	FAD_binding_4	87	223	6.1e-21	75.3
TkA05G088310	`PF17620`	ORF45	281	343	0.21	12.4
TkA05G088310	`PF08031`	BBE	472	527	1.5e-19	70.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card