TkA05G071280 | RubberDandelionOmics

Gene overview

TkA05G071280

Reference: TK1151 Chr: Chr05 Coordinates: 19023495-19028590 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1243 bp · TkA05G071280|TK1151|cDNA

GAAATATATAGCTGGCTGTCTAAAGCTACTGCAACTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTAAGGTGTTTCCCATTTCTCTCTGCAGACAAAACACACACAAACACACACTATTTGTATGAAATGTTCCGAAATCAATGAATGTGCTGCTGATTTTGGTCTTTATTTTGTAGCTAGTGTGGACATATTTTAGGGTTTTGATTTTTGCGGAGAAATTTTGCAGCTTTTTTTGGCCTGAAGCAGAGGAGAGTA...

CDS

Download CDS FASTA

597 bp · TkA05G071280|TK1151|CDS

ATGAGCGCATCTCGGTTTATAAAGTGCGTTACGGTCGGCGATGGAGCTGTCGGGAAGACCTGTATGCTTATTTCTTACACCAGCAACACTTTCCCCACTGATTATGTGCCAACAGTTTTTGACAATTTTAGTGCAAATGTTGTGGTGGATGGAAGCACTGTAAATCTTGGATTGTGGGATACTGCAGGTCAAGAAGATTACAATAGATTGAGACCTTTGAGTTATCGTGGTGCTGATGTCTTCATACTTGCATTTTCTCT...

Protein

Download Protein FASTA

198 aa · TkA05G071280|TK1151|PROTEIN

MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLSDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKGVFDAAIKVVLQPPKQKKKKKRRGQKACSIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G071280`
TK1151 ID	TkA05G071280
OH-1004 ID	LXL04_019650
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G071280

Location Chr05:19023495-19028590 (-)

Description Similar to RAC1: Rac-like GTP-binding protein RAC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35020`	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	Arabidopsis thaliana Rop GTPases are localized to tips of root hairs and control polar growth.2001 · DOI: 10.1093/emboj/20.11.2779 A ROP GTPase-dependent auxin signaling pathway regulates the subcellular distribution of PIN2 in Arabidopsis roots.2012 · DOI: 10.1016/j.cub.2012.05.019
`At2g17800`	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	No verified direct reference in this release
`At4g35950`	May be involved in cell polarity control during the actin-dependent tip growth of pollen tubes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019650 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0007165 signal transduction Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

GO:0032956 regulation of actin cytoskeleton organization Biological Process

GO:0043622 cortical microtubule organization Biological Process

KEGG gene cross-reference

ath:AT2G17800

ath:AT4G35020

dosa:Os02g0312600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.632

Rank 1 · TkA05G071280 · TK1151

Cytoplasm0.366

Rank 2 · TkA05G071280 · TK1151

Nucleus0.128

Rank 3 · TkA05G071280 · TK1151

Golgi apparatus0.083

Rank 4 · TkA05G071280 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA05G071280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf4-83 aa

PF00009GTP_EFTU6-23 aa

PF00071Ras8-178 aa

PF08477Roc8-121 aa

PF12775AAA_78-46 aa

PF00009GTP_EFTU44-176 aa

PF12775AAA_7159-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G071280	`PF00025`	Arf	4	83	0.0013	19.0
TkA05G071280	`PF00009`	GTP_EFTU	6	23	0.0034	17.7
TkA05G071280	`PF00071`	Ras	8	178	4.4e-49	166.9
TkA05G071280	`PF08477`	Roc	8	121	1e-23	84.5
TkA05G071280	`PF12775`	AAA_7	8	46	0.26	11.5
TkA05G071280	`PF00009`	GTP_EFTU	44	176	0.0034	17.7
TkA05G071280	`PF12775`	AAA_7	159	185	0.26	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38912`	Arabidopsis thaliana	sp\|Q38912\|RAC3_ARATH Rac-like GTP-binding protein ARAC3	90.400%	Swiss-Prot	High
`Q38902`	Arabidopsis thaliana	sp\|Q38902\|RAC1_ARATH Rac-like GTP-binding protein ARAC1	90.900%	Swiss-Prot	High
`Q9SBJ6`	Arabidopsis thaliana	sp\|Q9SBJ6\|RAC6_ARATH Rac-like GTP-binding protein ARAC6	89.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card