TkA05G059780 | RubberDandelionOmics

Gene overview

TkA05G059780

Reference: TK1151 Chr: Chr05 Coordinates: 15854540-15855004 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA05G059780|TK1151|cDNA

ATGTCTCTGGATTCTAAACGAACGACGATGGATGCAATCCATCATTTCAAACAGCAACTACAAGAAGAGATAAGGGAGAATCAACGACTAAAACAAGAGTTGAATCAAGCAAAGCTCAATTACGATGCACTCATGGCGGCGATCAAACAAAAACATGAGAAAAATCTTGATGAGTATCGGAAACCTAGCATTGATGGAGGAGGAGAGATTCCATTTCTTGGGTTAGCAGATCCGGTAGCCATGGAAGTCGATGAGAATTC...

CDS

Download CDS FASTA

465 bp · TkA05G059780|TK1151|CDS

ATGTCTCTGGATTCTAAACGAACGACGATGGATGCAATCCATCATTTCAAACAGCAACTACAAGAAGAGATAAGGGAGAATCAACGACTAAAACAAGAGTTGAATCAAGCAAAGCTCAATTACGATGCACTCATGGCGGCGATCAAACAAAAACATGAGAAAAATCTTGATGAGTATCGGAAACCTAGCATTGATGGAGGAGGAGAGATTCCATTTCTTGGGTTAGCAGATCCGGTAGCCATGGAAGTCGATGAGAATTC...

Protein

Download Protein FASTA

154 aa · TkA05G059780|TK1151|PROTEIN

MSLDSKRTTMDAIHHFKQQLQEEIRENQRLKQELNQAKLNYDALMAAIKQKHEKNLDEYRKPSIDGGGEIPFLGLADPVAMEVDENSRLSSEGRNRDEVSRKPINNHIYGKDQREENPEQALMCSNKVMRLNDVKTNDDGHNCWFDCSFAELER

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G059780`
TK1151 ID	TkA05G059780
OH-1004 ID	LXL04_017563
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.100
Protein coverage (%)	TK1151 91.558 / OH-1004 26.996 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G059780`
Location	Chr05:15854540-15855004 (+)
Description	Similar to WRKY6: WRKY transcription factor 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017563` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0080169 cellular response to boron-containing substance deprivation Biological Process GO:1900057 positive regulation of leaf senescence Biological Process GO:1901527 abscisic acid-activated signaling pathway involved in stomatal movement Biological Process GO:0005634 nucleus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G62300 ath:AT4G01720 ath:AT4G04450 ath:AT4G22070 osa:107276141 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.862

Rank 1 · TkA05G059780 · TK1151

Cytoplasm0.218

Rank 2 · TkA05G059780 · TK1151

Cell membrane0.033

Rank 3 · TkA05G059780 · TK1151

Mitochondrion0.027

Rank 4 · TkA05G059780 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA05G059780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26891Phage_N4_Gp16-47 aa

PF23735KIF98-57 aa

PF06156YabA8-51 aa

PF16566CREPT10-60 aa

PF28006HpsJ13-58 aa

PF29379ATG38_C14-54 aa

PF22326MMS21_N17-62 aa

PF04880NUDE_C22-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G059780	`PF26891`	Phage_N4_Gp1	6	47	0.59	11.1
TkA05G059780	`PF23735`	KIF9	8	57	0.0071	17.3
TkA05G059780	`PF06156`	YabA	8	51	1.3	10.4
TkA05G059780	`PF16566`	CREPT	10	60	0.33	11.7
TkA05G059780	`PF28006`	HpsJ	13	58	0.92	9.8
TkA05G059780	`PF29379`	ATG38_C	14	54	0.029	15.1
TkA05G059780	`PF22326`	MMS21_N	17	62	0.02	15.7
TkA05G059780	`PF04880`	NUDE_C	22	57	4.3	8.6
TkA05G059780	`PF21825`	Sequestin	28	58	0.1	13.2
TkA05G059780	`PF16566`	CREPT	78	136	0.33	11.7
TkA05G059780	`PF06156`	YabA	82	111	1.3	10.4
TkA05G059780	`PF04880`	NUDE_C	91	120	4.3	8.6
TkA05G059780	`PF26891`	Phage_N4_Gp1	98	151	0.59	11.1
TkA05G059780	`PF21825`	Sequestin	111	124	0.1	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card