TkA05G058720 | RubberDandelionOmics

Gene overview

TkA05G058720

Reference: TK1151 Chr: Chr05 Coordinates: 15578486-15579356 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

771 bp · TkA05G058720|TK1151|cDNA

ATCCATCCCAAACCATCTAAGCAAATGGCTTCTCATTTTGTTATTCTTGCAATACTCATCACGATAACATGTTCTATTGCCTTGGCATCCGACAATAGCCCACTTCAAGATTTTTGTGTTGCCGACACAAGTTGTCCACTCCAAGTGAACGGTTTAGCTTGCAAGGATCCAAAGCTTGTACAGGCAAGCGATTTCTTCTTCAGTGGACTAAACATGATTGGAAACACCTCAAATGCGGTGGGATCTCGAGTGACTCTAGT...

CDS

Download CDS FASTA

651 bp · TkA05G058720|TK1151|CDS

ATGGCTTCTCATTTTGTTATTCTTGCAATACTCATCACGATAACATGTTCTATTGCCTTGGCATCCGACAATAGCCCACTTCAAGATTTTTGTGTTGCCGACACAAGTTGTCCACTCCAAGTGAACGGTTTAGCTTGCAAGGATCCAAAGCTTGTACAGGCAAGCGATTTCTTCTTCAGTGGACTAAACATGATTGGAAACACCTCAAATGCGGTGGGATCTCGAGTGACTCTAGTGACTGTTGCACAACTACCTGGTCT...

Protein

Download Protein FASTA

216 aa · TkA05G058720|TK1151|PROTEIN

MASHFVILAILITITCSIALASDNSPLQDFCVADTSCPLQVNGLACKDPKLVQASDFFFSGLNMIGNTSNAVGSRVTLVTVAQLPGLNTLGISMARVDYAPWGINPPHTHPRATEILTVLEGTIQVGFVTSNPENRLITKVLQKGDVFVFPEGLVHFQRNVGYGNAVAIVGLSSQNPGVITVANAVFGANPDIPDDLLAKSFQVDVEVVDQIQSKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G058720`
TK1151 ID	TkA05G058720
OH-1004 ID	LXL04_019412
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.600
Protein coverage (%)	TK1151 77.315 / OH-1004 15.637 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G058720

Location Chr05:15578486-15579356 (-)

Description Similar to Os02g0491600: Putative germin-like protein 2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0491600`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491800`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491700`	May play a role in plant defense.	No verified direct reference in this release
`Os08g0189100`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release
`Os08g0189600`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019412 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048046 apoplast Cellular Component

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0491600

dosa:Os02g0491700

dosa:Os02g0491800

dosa:Os08g0189100

dosa:Os08g0189850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.475

Rank 1 · TkA05G058720 · TK1151

Lysosome / Vacuole0.239

Rank 2 · TkA05G058720 · TK1151

Endoplasmic reticulum0.104

Rank 3 · TkA05G058720 · TK1151

Cytoplasm0.102

Rank 4 · TkA05G058720 · TK1151

Cell membrane0.054

Rank 5 · TkA05G058720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_161-209 aa

PF07883Cupin_296-169 aa

PF19480DUF6016106-128 aa

PF05899Cupin_3112-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G058720	`PF00190`	Cupin_1	61	209	1.2e-52	178.2
TkA05G058720	`PF07883`	Cupin_2	96	169	1.9e-09	37.8
TkA05G058720	`PF19480`	DUF6016	106	128	0.15	12.4
TkA05G058720	`PF05899`	Cupin_3	112	154	0.023	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6K5Q0`	Oryza sativa subsp. japonica	sp\|Q6K5Q0\|GL21_ORYSJ Putative germin-like protein 2-1	65.700%	Swiss-Prot	High
`Q6K5P8`	Oryza sativa subsp. japonica	sp\|Q6K5P8\|GL23_ORYSJ Putative germin-like protein 2-3	68.300%	Swiss-Prot	High
`Q6K5P9`	Oryza sativa subsp. japonica	sp\|Q6K5P9\|GL22_ORYSJ Putative germin-like protein 2-2	68.200%	Swiss-Prot	High
`Q6YZA9`	Oryza sativa subsp. japonica	sp\|Q6YZA9\|GL82_ORYSJ Germin-like protein 8-2	64.000%	Swiss-Prot	High
`Q6YZZ2`	Oryza sativa subsp. japonica	sp\|Q6YZZ2\|GL87_ORYSJ Germin-like protein 8-7	62.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card