LXL04_019412 | RubberDandelionOmics

Gene overview

LXL04_019412

Reference: OH-1004 Chr: Chr04 Coordinates: 30731328-30737417 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3207 bp · LXL04_019412|LXL04_019412|OH1004|cDNA

atGGGATTCTCGATCAGGTGGGAGCTTCTATTGCAAATTAATCATAACAGTTTAAAACTCAGACACATAAGATGTTTACTAGTGAACGGTTTCGCTTGCAAAGATCCGAAGCTTGTAACTGCGAGCGATTTCTTCTTTAGTGGACTACACCTAAAGGGAAACACCTCAAATGCCATGGGATCTAAAGGGACTCTAGTGACCGTTGCCCAATTACCAGGTCTCAACACTCTTGGCATCTCAATGGCTCGTATTGACTTCGC...

CDS

Download CDS FASTA

3207 bp · LXL04_019412|LXL04_019412|OH1004|CDS

ATGGGATTCTCGATCAGGTGGGAGCTTCTATTGCAAATTAATCATAACAGTTTAAAACTCAGACACATAAGATGTTTACTAGTGAACGGTTTCGCTTGCAAAGATCCGAAGCTTGTAACTGCGAGCGATTTCTTCTTTAGTGGACTACACCTAAAGGGAAACACCTCAAATGCCATGGGATCTAAAGGGACTCTAGTGACCGTTGCCCAATTACCAGGTCTCAACACTCTTGGCATCTCAATGGCTCGTATTGACTTCGC...

Protein

Download Protein FASTA

1068 aa · LXL04_019412|LXL04_019412|OH1004|PROTEIN

MGFSIRWELLLQINHNSLKLRHIRCLLVNGFACKDPKLVTASDFFFSGLHLKGNTSNAMGSKGTLVTVAQLPGLNTLGISMARIDFAPWGINPPHTHPRATEILTIIEGTIQVGFITSNPENRLITKVLQKGDVFVFPQGLVHFQRNIGNGNVVGIAGLSSQNPGVNTIGNAVFGANPDIPDDLLAKAFQVDSIHTMAEFSRKNKEKLFDLEYVRDEVSDDDLLDMSFIDCEPETFKPSSTMSNDPFLNMLCDQNIFNNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019412`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019412

Location Chr04:30731328-30737417 (+)

Description Similar to Os02g0491600: Putative germin-like protein 2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0491600`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491700`	May play a role in plant defense.	No verified direct reference in this release
`Os02g0491800`	May play a role in plant defense.	No verified direct reference in this release
`Os08g0189100`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release
`Os08g0189850`	Plays a role in broad-spectrum disease resistance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019412 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048046 apoplast Cellular Component

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0491600

dosa:Os02g0491700

dosa:Os02g0491800

dosa:Os08g0189100

dosa:Os08g0189850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.929

Rank 1 · LXL04_019412 · OH-1004

Cytoplasm0.115

Rank 2 · LXL04_019412 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_019412 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_019412 · OH-1004

Mitochondrion0.015

Rank 5 · LXL04_019412 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190.29Cupin_149-193 aa

PF07883.18Cupin_284-153 aa

PF03108.21DBD_Tnp_Mut309-374 aa

PF10551.16MULE507-603 aa

PF00872.25Transposase_mut525-604 aa

PF04434.23SWIM755-783 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019412	`PF00190.29`	Cupin_1	49	193	5.7e-47	159.8
LXL04_019412	`PF07883.18`	Cupin_2	84	153	1.3e-07	31.9
LXL04_019412	`PF03108.21`	DBD_Tnp_Mut	309	374	5.3e-09	36.3
LXL04_019412	`PF10551.16`	MULE	507	603	2.7e-16	60.5
LXL04_019412	`PF00872.25`	Transposase_mut	525	604	2e-08	34.3
LXL04_019412	`PF04434.23`	SWIM	755	783	8.4e-07	29.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6K5Q0`	Oryza sativa subsp. japonica	Putative germin-like protein 2-1	71.257%	Swiss-Prot	weak database homology
`Q6K5P9`	Oryza sativa subsp. japonica	Putative germin-like protein 2-2	68.391%	Swiss-Prot	weak database homology
`Q6K5P8`	Oryza sativa subsp. japonica	Putative germin-like protein 2-3	69.697%	Swiss-Prot	weak database homology
`Q6YZA9`	Oryza sativa subsp. japonica	Germin-like protein 8-2	66.467%	Swiss-Prot	weak database homology
`Q6YZ99`	Oryza sativa subsp. japonica	Germin-like protein 8-9	65.269%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card