TkA05G056150 | RubberDandelionOmics

Gene overview

TkA05G056150

Reference: TK1151 Chr: Chr05 Coordinates: 14933939-14936002 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2064 bp · TkA05G056150|TK1151|cDNA

ATGTCACTGGTTAGGACTAAACTCAAACACCTTTCTTGCATCCGCAATCGCACCTTCTCACACTTCTCTACTCCCCACAGCCACCACCACTACCACGACGGTCGCCGCCGTCAACCACAATCTCCTAAACAAGACCCATACTCTCTCTTGAAAGAGGATCCAGTTCAAGTCCTCTCTGATTTATGGGTCCGAACCTTCTCAGACCACAACCAGACCCCATTCTCCAACCTCACCGGTTTCCTCTCCAAACTCGACCTCTG...

CDS

Download CDS FASTA

2064 bp · TkA05G056150|TK1151|CDS

ATGTCACTGGTTAGGACTAAACTCAAACACCTTTCTTGCATCCGCAATCGCACCTTCTCACACTTCTCTACTCCCCACAGCCACCACCACTACCACGACGGTCGCCGCCGTCAACCACAATCTCCTAAACAAGACCCATACTCTCTCTTGAAAGAGGATCCAGTTCAAGTCCTCTCTGATTTATGGGTCCGAACCTTCTCAGACCACAACCAGACCCCATTCTCCAACCTCACCGGTTTCCTCTCCAAACTCGACCTCTG...

Protein

Download Protein FASTA

687 aa · TkA05G056150|TK1151|PROTEIN

MSLVRTKLKHLSCIRNRTFSHFSTPHSHHHYHDGRRRQPQSPKQDPYSLLKEDPVQVLSDLWVRTFSDHNQTPFSNLTGFLSKLDLWVLAYQRTCAHFTGSFPSRNAIQSHVLTDLLSLRNAVVHGQYQWNMKIQPYIQNPNDKTPFAKLSSRKLRTISESNEAPFQDTVVQELLLMILEPIFEPRFSPKSHGFRPRRNAHTVIRTIRSNFAGYVWFLKGDLTPIFDNVDVKLLIGFVEKGLKDQKVLSLLKSGLKDLPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G056150`
TK1151 ID	TkA05G056150
OH-1004 ID	LXL04_010604
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	51.200
Protein coverage (%)	TK1151 90.684 / OH-1004 82.400 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G056150

Location Chr05:14933939-14936002 (-)

Description Similar to NMAT2: Nuclear intron maturase 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30010`	Nuclear-encoded maturase required for splicing of group-II introns in mitochondria.	A mutation in At-nMat1a, which encodes a nuclear gene having high similarity to group II intron maturase, causes impaired splicing of mitochondrial NAD4 transcript and altered carbon metabolism in Arabidopsis thaliana.2006 · DOI: 10.1093/pcp/pcj051 nMAT1, a nuclear-encoded maturase involved in the trans-splicing of nad1 intron 1, is essential for mitochondrial complex I assembly and function.2012 · DOI: 10.1111/j.1365-313x.2012.04998.x
`At5g46920`	Nuclear-encoded maturase required for splicing of group-II introns in mitochondria.	AtnMat2, a nuclear-encoded maturase required for splicing of group-II introns in Arabidopsis mitochondria.2009 · DOI: 10.1261/rna.1776409 nMAT1, a nuclear-encoded maturase involved in the trans-splicing of nad1 intron 1, is essential for mitochondrial complex I assembly and function.2012 · DOI: 10.1111/j.1365-313x.2012.04998.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010604 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0000374 Group III intron splicing Biological Process

GO:0006314 intron homing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009845 seed germination Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010896 regulation of triglyceride catabolic process Biological Process

GO:0032885 regulation of polysaccharide biosynthetic process Biological Process

GO:0090351 seedling development Biological Process

GO:0090615 mitochondrial mRNA processing Biological Process

KEGG gene cross-reference

ath:AT1G30010

ath:AT5G46920

llm:llmg_1371

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.812

Rank 1 · TkA05G056150 · TK1151

Plastid0.098

Rank 2 · TkA05G056150 · TK1151

Nucleus0.077

Rank 3 · TkA05G056150 · TK1151

Cytoplasm0.050

Rank 4 · TkA05G056150 · TK1151

Cell membrane0.017

Rank 5 · TkA05G056150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_1166-239 aa

PF00078RVT_1319-433 aa

PF01348Intron_maturas2513-579 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G056150	`PF00078`	RVT_1	166	239	7.2e-07	30.0
TkA05G056150	`PF00078`	RVT_1	319	433	7.2e-07	30.0
TkA05G056150	`PF01348`	Intron_maturas2	513	579	1.1e-05	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8R8`	Arabidopsis thaliana	sp\|Q9C8R8\|NMAT1_ARATH Nuclear intron maturase 1, mitochondrial	60.200%	Swiss-Prot	High
`Q9FJR9`	Arabidopsis thaliana	sp\|Q9FJR9\|NMAT2_ARATH Nuclear intron maturase 2, mitochondrial	50.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card