TkA05G053460 | RubberDandelionOmics

Gene overview

TkA05G053460

Reference: TK1151 Chr: Chr05 Coordinates: 14213416-14214807 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

717 bp · TkA05G053460|TK1151|cDNA

TACGATTCTTCAATCGACTACAATCACTCTAATGGTATGTTTGGAATCAGGAAGGATCTGTATGGGAAAACATGAAACAAATTTGCTGTGGGAAGTGGAGCTAAAACTGTTTGTATATGTTACTATGAGCAGGAGAATAACTGGTGGGTTAGTAAGCTAATCAGGAAAAAGCATGATTCATCTGTCACCAGTGTTGCTTGGCATCCTAATAATGTTTGTATTCTCTCTTATTCCATTTAACCTTTTTTGAAAATTTGGTA...

CDS

Download CDS FASTA

318 bp · TkA05G053460|TK1151|CDS

ATGAACACTTTAGACGAAATACAAAGGATAACAGTAAAAGATGTTGCAGACTTGGGACTTATCAAACTACAGCAGGGTAGGAAAGATAGCTGGTTCATTCCTACAAAATTGGCTACCAACCTCTCTATTAGCTTATCAGATTCATCATCAAGGAAAATGGGATATGTTGTTGTGGAAACAAACTTCAGGCTATATGCCTACTCAACCTCTAAGTTACATTGTGAAATCTTAAGACTCTTTGCAAGATCAGCAGAATGCTC...

Protein

Download Protein FASTA

105 aa · TkA05G053460|TK1151|PROTEIN

MNTLDEIQRITVKDVADLGLIKLQQGRKDSWFIPTKLATNLSISLSDSSSRKMGYVVVETNFRLYAYSTSKLHCEILRLFARSAECSSSCCRKSTICTRKCHRSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G053460`
TK1151 ID	TkA05G053460
OH-1004 ID	LXL04_010227
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 78.095 / OH-1004 18.142 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G053460

Location Chr05:14213416-14214807 (-)

Description Similar to TFB2: General transcription and DNA repair factor IIH subunit TFB2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17020`	Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010227 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0000112 nucleotide-excision repair factor 3 complex Cellular Component

GO:0000438 core TFIIH complex portion of holo TFIIH complex Cellular Component

GO:0000439 transcription factor TFIIH core complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005669 transcription factor TFIID complex Cellular Component

GO:0005675 transcription factor TFIIH holo complex Cellular Component

KEGG gene cross-reference

ath:AT4G17020

hsa:2968

mmu:14885

ptr:462549

spo:2539790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.479

Rank 1 · TkA05G053460 · TK1151

Cytoplasm0.422

Rank 2 · TkA05G053460 · TK1151

Mitochondrion0.080

Rank 3 · TkA05G053460 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA05G053460 · TK1151

Cell membrane0.060

Rank 5 · TkA05G053460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03849Tfb22-82 aa

PF22008BpuSI_TRD28-71 aa

PF20188DUF655141-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G053460	`PF03849`	Tfb2	2	82	7.7e-23	81.7
TkA05G053460	`PF22008`	BpuSI_TRD	28	71	0.19	11.8
TkA05G053460	`PF20188`	DUF6551	41	93	0.042	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q680U9`	Arabidopsis thaliana	sp\|Q680U9\|TFB2_ARATH General transcription and DNA repair factor IIH subunit TFB2	80.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card