TkA05G048160 | RubberDandelionOmics

Gene overview

TkA05G048160

Reference: TK1151 Chr: Chr05 Coordinates: 12664830-12665186 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA05G048160|TK1151|cDNA

CTCATTTCCTTTTTATCACCATTTACAGATCTCTATCTCTCTCTCGCCACTACCACCACGACCACCACTTCCCCATCACTCCCACCTCCATCAACACCGCGTTCTTCTCGCATGGATCGCGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAGAATCACCAAGGAAGAACTCAACGATTCGTTGGAGAACATGGGCATATTCATCCCGGACTCAGATCTCACTCAAATGATCGAAAATATCGA...

CDS

Download CDS FASTA

357 bp · TkA05G048160|TK1151|CDS

CTCATTTCCTTTTTATCACCATTTACAGATCTCTATCTCTCTCTCGCCACTACCACCACGACCACCACTTCCCCATCACTCCCACCTCCATCAACACCGCGTTCTTCTCGCATGGATCGCGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAGAATCACCAAGGAAGAACTCAACGATTCGTTGGAGAACATGGGCATATTCATCCCGGACTCAGATCTCACTCAAATGATCGAAAATATCGA...

Protein

Download Protein FASTA

118 aa · TkA05G048160|TK1151|PROTEIN

LISFLSPFTDLYLSLATTTTTTTSPSLPPPSTPRSSRMDRDQLQRIFQMFDKNGDARITKEELNDSLENMGIFIPDSDLTQMIENIDENHDGCVDIDEFGALYKSIMDDRDHEEDVYR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G048160`
TK1151 ID	TkA05G048160
OH-1004 ID	LXL04_038844
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 91.525 / OH-1004 56.842 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G048160

Location Chr05:12664830-12665186 (-)

Description Similar to CML5: Calmodulin-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07490`	Potential calcium sensor.	No verified direct reference in this release
`At2g43290`	Potential calcium sensor.	No verified direct reference in this release
`At1g05990`	Potential calcium sensor.	No verified direct reference in this release
`At4g12860`	Potential calcium sensor that is required for pollen tube attraction for ovule fertilization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0228800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT2G43290

ath:AT3G07490

ath:AT3G59440

ath:AT4G03290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.454

Rank 1 · TkA05G048160 · TK1151

Nucleus0.380

Rank 2 · TkA05G048160 · TK1151

Endoplasmic reticulum0.116

Rank 3 · TkA05G048160 · TK1151

Cell membrane0.099

Rank 4 · TkA05G048160 · TK1151

Mitochondrion0.083

Rank 5 · TkA05G048160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591SPARC_Ca_bdg36-100 aa

PF23564EF-hand_FSTL137-70 aa

PF12763EH38-108 aa

PF30624EF_SSP12040-62 aa

PF13499EF-hand_741-103 aa

PF13405EF-hand_642-71 aa

PF00036EF-hand_143-66 aa

PF24548EF_EFCAB10_C43-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G048160	`PF10591`	SPARC_Ca_bdg	36	100	0.048	14.7
TkA05G048160	`PF23564`	EF-hand_FSTL1	37	70	0.0001	23.4
TkA05G048160	`PF12763`	EH	38	108	0.002	18.7
TkA05G048160	`PF30624`	EF_SSP120	40	62	0.0043	18.4
TkA05G048160	`PF13499`	EF-hand_7	41	103	2.5e-13	50.9
TkA05G048160	`PF13405`	EF-hand_6	42	71	8.4e-11	41.3
TkA05G048160	`PF00036`	EF-hand_1	43	66	2.6e-12	46.1
TkA05G048160	`PF24548`	EF_EFCAB10_C	43	86	0.00068	19.9
TkA05G048160	`PF13202`	EF-hand_5	44	64	2.6e-08	33.7
TkA05G048160	`PF17959`	EF-hand_14	45	91	0.0022	19.0
TkA05G048160	`PF13833`	EF-hand_8	55	102	0.0014	19.0
TkA05G048160	`PF26110`	GAPS4b_N	57	84	0.021	15.2
TkA05G048160	`PF24085`	DUF7370	58	95	0.058	14.5
TkA05G048160	`PF00036`	EF-hand_1	79	105	2.6e-12	46.1
TkA05G048160	`PF30624`	EF_SSP120	80	99	0.0043	18.4
TkA05G048160	`PF13405`	EF-hand_6	84	105	8.4e-11	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRR7`	Arabidopsis thaliana	sp\|Q9SRR7\|CML3_ARATH Calmodulin-like protein 3	69.600%	Swiss-Prot	Medium
`O22845`	Arabidopsis thaliana	sp\|O22845\|CML5_ARATH Calmodulin-like protein 5	68.200%	Swiss-Prot	High
`Q9LNE7`	Arabidopsis thaliana	sp\|Q9LNE7\|CML7_ARATH Calmodulin-like protein 7	59.000%	Swiss-Prot	Medium
`Q9SU00`	Arabidopsis thaliana	sp\|Q9SU00\|CML2_ARATH Calmodulin-like protein 2	49.400%	Swiss-Prot	Medium
`Q2QVI1`	Oryza sativa subsp. japonica	sp\|Q2QVI1\|CML28_ORYSJ Probable calcium-binding protein CML28	58.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card