LXL04_038844 | RubberDandelionOmics

Gene overview

LXL04_038844

Reference: OH-1004 Chr: Chr09 Coordinates: 51808181-51809447 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_038844|LXL04_038844|OH1004|cDNA

ATGCTGAATACAGTACCATACCATGACTCGCGTAACTGCCCAGTCAAGAAGAAGCAAGTCGTCGAGAGTCTTCAAATTGCACAAATTCatctctatctctctctcgCCACTACCACCACGACCACCACTTCCCCATCACTCCCACCTCCATCAACACCGCGTTCTTCTCGCATGGATCGCGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAGAATCACCAAGGAAGAACTCAACGATTCGTT...

CDS

Download CDS FASTA

573 bp · LXL04_038844|LXL04_038844|OH1004|CDS

ATGCTGAATACAGTACCATACCATGACTCGCGTAACTGCCCAGTCAAGAAGAAGCAAGTCGTCGAGAGTCTTCAAATTGCACAAATTCATCTCTATCTCTCTCTCGCCACTACCACCACGACCACCACTTCCCCATCACTCCCACCTCCATCAACACCGCGTTCTTCTCGCATGGATCGCGACCAGCTCCAACGCATCTTCCAGATGTTCGACAAAAACGGAGATGCGAGAATCACCAAGGAAGAACTCAACGATTCGTT...

Protein

Download Protein FASTA

190 aa · LXL04_038844|LXL04_038844|OH1004|PROTEIN

MLNTVPYHDSRNCPVKKKQVVESLQIAQIHLYLSLATTTTTTTSPSLPPPSTPRSSRMDRDQLQRIFQMFDKNGDARITKEELNDSLENMGIFIPDSDLTQMIENIDENHDGCVDIDEFGALYKSIMDDRDHEEDVYRSGFGGCPPRIQPVCDYFEKTRSDVFEKTRTESDVNMMIIKRSDQRPSPWSEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038844`
TK1151 ID	TkA05G048160
OH-1004 ID	LXL04_038844
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 91.525 / OH-1004 56.842 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038844

Location Chr09:51808181-51809447 (+)

Description Similar to CML5: Calmodulin-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43290`	Potential calcium sensor.	No verified direct reference in this release
`At3g59440`	Potential calcium sensor.	No verified direct reference in this release
`At3g07490`	Potential calcium sensor.	No verified direct reference in this release
`At1g05990`	Potential calcium sensor.	No verified direct reference in this release
`At4g03290`	Potential calcium sensor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038844 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT2G43290

ath:AT3G07490

ath:AT3G59440

ath:AT4G03290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · LXL04_038844 · OH-1004

Nucleus0.415

Rank 2 · LXL04_038844 · OH-1004

Cell membrane0.119

Rank 3 · LXL04_038844 · OH-1004

Mitochondrion0.098

Rank 4 · LXL04_038844 · OH-1004

Endoplasmic reticulum0.082

Rank 5 · LXL04_038844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_761-123 aa

PF13405.13EF-hand_662-91 aa

PF00036.39EF-hand_163-86 aa

PF13202.13EF-hand_564-84 aa

PF00036.39EF-hand_199-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038844	`PF13499.13`	EF-hand_7	61	123	6e-13	49.6
LXL04_038844	`PF13405.13`	EF-hand_6	62	91	3.7e-10	39.3
LXL04_038844	`PF00036.39`	EF-hand_1	63	86	1.1e-11	44.1
LXL04_038844	`PF13202.13`	EF-hand_5	64	84	1.4e-07	31.4
LXL04_038844	`PF00036.39`	EF-hand_1	99	125	1.1e-11	44.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22845`	Arabidopsis thaliana	Calmodulin-like protein 5	63.736%	Swiss-Prot	weak database homology
`Q9LX27`	Arabidopsis thaliana	Calmodulin-like protein 4	59.574%	Swiss-Prot	weak database homology
`Q9SRR7`	Arabidopsis thaliana	Calmodulin-like protein 3	71.014%	Swiss-Prot	weak database homology
`Q9LNE7`	Arabidopsis thaliana	Calmodulin-like protein 7	67.143%	Swiss-Prot	weak database homology
`Q9ZR02`	Arabidopsis thaliana	Calmodulin-like protein 6	62.857%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card