TkA05G035480 | RubberDandelionOmics

Gene overview

TkA05G035480

Reference: TK1151 Chr: Chr05 Coordinates: 9589279-9593132 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3455 bp · TkA05G035480|TK1151|cDNA

TTTTCACATCATGTTTTACAAGATAATAGTCCGCCATTAACACCAAATTTCGTCGTTATAACATAATCAGATGATACATACAGTACCGTATATATAATTTCTGACAATAATACTGAGAGAGTGTTGAGAAAATTCAAATCTTTGAAAACATACGAATATAAGAAGGCAGAAGAAGTTGCTATCATCACTCGACAAAACCCAGAATCTGTCATCGATGATTCAGCAGATAAACCACATATAGGCTCTGATAGGCTTCATCC...

CDS

Download CDS FASTA

3000 bp · TkA05G035480|TK1151|CDS

ATGCTCATTGCTTCCAAAATGAAGCTACCATTCCTCACTTATTTTGTCTTGTTTGTCTTGTTCAGTTGTAGTCATTCGGCTAAACCCTATTCTTCACTGAAAGAACAAGCGTCGATTCTGGTTTCCTTGAAACAGTCTTTTGGAGTCTCCGATCACCCTTTTTTGGCCGGATGGAACTTTGTCGATTACAATTCCGTTTGTTCGAATTGGAGCGGTGTTACCTGCGATAACGCTACCTTTTCCGTCGTTTCTCTTGATAT...

Protein

Download Protein FASTA

999 aa · TkA05G035480|TK1151|PROTEIN

MLIASKMKLPFLTYFVLFVLFSCSHSAKPYSSLKEQASILVSLKQSFGVSDHPFLAGWNFVDYNSVCSNWSGVTCDNATFSVVSLDISNLNLSGVLSPAVTQLRSLESLSVSGNGFVGAFPARVHELTRLRFLNISNNVFDGGLEFNFTLLRRIEVLDAYNNNFSGLLPAGVSRLTSLQHLNLGGNYFSGEIPASYGGLQLLTFLHLGGNDLRGFIPGHLGNLTNLKQLSLGYFNQFDGGIPVEFGKLVNLVHLDLSNCG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G035480`
TK1151 ID	TkA05G035480
OH-1004 ID	LXL04_006581
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.900
Protein coverage (%)	TK1151 38.639 / OH-1004 37.033 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G035480

Location Chr05:9589279-9593132 (-)

Description Similar to BAM1: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20270`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to BAM1 and CLV1, participates in the detection of CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At3g49670`	LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At1g75820`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to BAM1 and BAM3, participates in the detection of CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	Stem cell signaling in Arabidopsis requires CRN to localize CLV2 to the plasma membrane.2010 · DOI: 10.1104/pp.109.149930 Receptor-like cytoplasmic kinase MAZZA mediates developmental processes with CLAVATA1 family receptors in Arabidopsis.2021 · DOI: 10.1093/jxb/erab183 A CLE-BAM-CIK signalling module controls root protophloem differentiation in Arabidopsis.2022 · DOI: 10.1111/nph.17791 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006581 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007172 signal complex assembly Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0036289 peptidyl-serine autophosphorylation Biological Process

GO:0045595 regulation of cell differentiation Biological Process

GO:0048229 gametophyte development Biological Process

GO:0048437 floral organ development Biological Process

KEGG gene cross-reference

ath:AT1G75820

ath:AT3G49670

ath:AT4G20270

ath:AT5G65700

mtr:11439632

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.877

Rank 1 · TkA05G035480 · TK1151

Endoplasmic reticulum0.083

Rank 2 · TkA05G035480 · TK1151

Cytoplasm0.062

Rank 3 · TkA05G035480 · TK1151

Nucleus0.036

Rank 4 · TkA05G035480 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA05G035480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_234-76 aa

PF25019LRR_R13L1-DRL2167-112 aa

PF00560LRR_182-102 aa

PF13855LRR_883-138 aa

PF23211LRR_LRWD183-140 aa

PF12799LRR_484-116 aa

PF25013LRR_Zer-184-138 aa

PF29594LRR_SKP284-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G035480	`PF08263`	LRRNT_2	34	76	3.4e-07	31.1
TkA05G035480	`PF25019`	LRR_R13L1-DRL21	67	112	4e-05	24.3
TkA05G035480	`PF00560`	LRR_1	82	102	4.8e-51	160.4
TkA05G035480	`PF13855`	LRR_8	83	138	4.6e-36	123.1
TkA05G035480	`PF23211`	LRR_LRWD1	83	140	0.031	14.7
TkA05G035480	`PF12799`	LRR_4	84	116	6.4e-36	122.3
TkA05G035480	`PF25013`	LRR_Zer-1	84	138	1.3e-07	32.5
TkA05G035480	`PF29594`	LRR_SKP2	84	135	0.4	10.6
TkA05G035480	`PF24758`	LRR_At5g56370	95	138	3.7e-06	27.5
TkA05G035480	`PF23598`	LRR_14	96	157	7.8e-28	97.9
TkA05G035480	`PF13516`	LRR_6	103	115	1.4e-05	25.5
TkA05G035480	`PF00560`	LRR_1	105	122	4.8e-51	160.4
TkA05G035480	`PF12799`	LRR_4	105	138	6.4e-36	122.3
TkA05G035480	`PF29247`	LRR_MHP1-HER1-GIP3	106	138	0.35	10.7
TkA05G035480	`PF23286`	LRR_13	108	136	0.0016	18.9
TkA05G035480	`PF24141`	LRR_ComC	116	216	6.2e-10	39.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65440`	Arabidopsis thaliana	sp\|O65440\|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3	66.100%	Swiss-Prot	Low
`O49545`	Arabidopsis thaliana	sp\|O49545\|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	63.600%	Swiss-Prot	Low
`Q9M2Z1`	Arabidopsis thaliana	sp\|Q9M2Z1\|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	62.600%	Swiss-Prot	Low
`Q9SYQ8`	Arabidopsis thaliana	sp\|Q9SYQ8\|CLV1_ARATH Receptor protein kinase CLAVATA1	58.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card