TkA05G032800 | RubberDandelionOmics

Gene overview

TkA05G032800

Reference: TK1151 Chr: Chr05 Coordinates: 8847238-8847952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

351 bp · TkA05G032800|TK1151|cDNA

ATGAAAGAATCAGAACTGCATCATTACGGGAAGAAAGAAATCAGTAACATGACTTTATCATCTTCTTCAAAACTCACACTTCCAAGCTCTCACTGCGACTCTACCAGACCTCCTGTCCTCCCCTACCGGCGCTGCCTTTCCCCGTCTCCGTCTTCACGTCTCCACACCAGATCGGATCTGTTCATCGGAGAAGATCTACCTGAAACGCACTTTAGACCTTGGGCGTCCGCCATGGCAACCGCTTACCAGTCGCTGGAGAA...

CDS

Download CDS FASTA

351 bp · TkA05G032800|TK1151|CDS

ATGAAAGAATCAGAACTGCATCATTACGGGAAGAAAGAAATCAGTAACATGACTTTATCATCTTCTTCAAAACTCACACTTCCAAGCTCTCACTGCGACTCTACCAGACCTCCTGTCCTCCCCTACCGGCGCTGCCTTTCCCCGTCTCCGTCTTCACGTCTCCACACCAGATCGGATCTGTTCATCGGAGAAGATCTACCTGAAACGCACTTTAGACCTTGGGCGTCCGCCATGGCAACCGCTTACCAGTCGCTGGAGAA...

Protein

Download Protein FASTA

116 aa · TkA05G032800|TK1151|PROTEIN

MKESELHHYGKKEISNMTLSSSSKLTLPSSHCDSTRPPVLPYRRCLSPSPSSRLHTRSDLFIGEDLPETHFRPWASAMATAYQSLEKIYLKRMSITDEDLEMIARSFPSFKVNHGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G032800`
TK1151 ID	TkA05G032800
OH-1004 ID	LXL04_031125
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 36.207 / OH-1004 7.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G032800

Location Chr05:8847238-8847952 (+)

Description Similar to At5g49980: Transport inhibitor response 1-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49980`	Transport inhibitor response 1-like protein.	No verified direct reference in this release
`At4g24390`	F-box protein FBX14.	No verified direct reference in this release
`At3g62980`	Auxin receptor that mediates Aux/IAA proteins proteasomal degradation and auxin-regulated transcription.	Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana.1999 · DOI: 10.1101/gad.13.13.1678 Five components of the ethylene-response pathway identified in a screen for weak ethylene-insensitive mutants in Arabidopsis.2003 · DOI: 10.1073/pnas.0438070100 The Arabidopsis F-box protein TIR1 is an auxin receptor.2005 · DOI: 10.1038/nature03542 A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088 Small-molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling.2008 · DOI: 10.1073/pnas.0711146105 The TIR1 protein of Arabidopsis functions in auxin response and is related to human SKP2 and yeast grr1p.1998 · DOI: 10.1101/gad.12.2.198

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031125 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010152 pollen maturation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0048443 stamen development Biological Process

GO:0048527 lateral root development Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0080022 primary root development Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G12820

ath:AT3G26810

ath:AT4G24390

ath:AT5G49980

dosa:Os04g0395600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.634

Rank 1 · TkA05G032800 · TK1151

Cytoplasm0.291

Rank 2 · TkA05G032800 · TK1151

Cell membrane0.086

Rank 3 · TkA05G032800 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA05G032800 · TK1151

Mitochondrion0.048

Rank 5 · TkA05G032800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18791Transp_inhibit70-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G032800	`PF18791`	Transp_inhibit	70	90	0.0011	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTX2`	Arabidopsis thaliana	sp\|Q9LTX2\|TIR1L_ARATH Transport inhibitor response 1-like protein	59.500%	Swiss-Prot	Low
`Q8RWQ8`	Arabidopsis thaliana	sp\|Q8RWQ8\|FBX14_ARATH F-box protein FBX14	58.500%	Swiss-Prot	Low
`Q570C0`	Arabidopsis thaliana	sp\|Q570C0\|TIR1_ARATH Protein TRANSPORT INHIBITOR RESPONSE 1	57.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card