LXL04_031125 | RubberDandelionOmics

Gene overview

LXL04_031125

Reference: OH-1004 Chr: Chr07 Coordinates: 913111-915205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1803 bp · LXL04_031125|LXL04_031125|OH1004|cDNA

ATGTCTGAAGATGACGGGGGCTGCGGCGGTGGTAAGCTGAGAAACTCAGTTGCCGGCACCGGAGCTGAACCCGGAGAGTTTTTCACGCCGTACCCAGATCAGGTTCTTGAAAACGTACTTGAAAACGTTTTGGTTTTCCTGAAATCACGGCGTGACCGTAACGCCGTTTCCCTCGTCTGCAAATCATGGTACCGCGCGGAAGCGTACACCAGATCGGATCTATTCATCGGAAACTGTTACTCTGTGTCTCCACGGCGGGT...

CDS

Download CDS FASTA

1803 bp · LXL04_031125|LXL04_031125|OH1004|CDS

ATGTCTGAAGATGACGGGGGCTGCGGCGGTGGTAAGCTGAGAAACTCAGTTGCCGGCACCGGAGCTGAACCCGGAGAGTTTTTCACGCCGTACCCAGATCAGGTTCTTGAAAACGTACTTGAAAACGTTTTGGTTTTCCTGAAATCACGGCGTGACCGTAACGCCGTTTCCCTCGTCTGCAAATCATGGTACCGCGCGGAAGCGTACACCAGATCGGATCTATTCATCGGAAACTGTTACTCTGTGTCTCCACGGCGGGT...

Protein

Download Protein FASTA

600 aa · LXL04_031125|LXL04_031125|OH1004|PROTEIN

MSEDDGGCGGGKLRNSVAGTGAEPGEFFTPYPDQVLENVLENVLVFLKSRRDRNAVSLVCKSWYRAEAYTRSDLFIGNCYSVSPRRVMDRFKRVRSISLKGKPRFADFSLLPADWGAHFRPWASAMATAYQSLEKIYLKRMSITDEDLEMIARSFPSFKELVLVCCEGFGTSGLAIIARDCRYLRVLELIEDEVSDDETDWISCFPQEGTTNLESLSFDCVEYPINFDALERLVARSPLLKKLRLNRYVSIGQLYRLILR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031125`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031125

Location Chr07:913111-915205 (+)

Description Similar to At5g49980: Transport inhibitor response 1-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49980`	Transport inhibitor response 1-like protein.	No verified direct reference in this release
`At4g24390`	F-box protein FBX14.	No verified direct reference in this release
`At1g12820`	Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity).	No verified direct reference in this release
`At3g26810`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0395600`	Transport inhibitor response 1-like protein Os04g0395600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031125 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010152 pollen maturation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0048443 stamen development Biological Process

GO:0048527 lateral root development Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0080022 primary root development Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G12820

ath:AT3G26810

ath:AT4G24390

ath:AT5G49980

dosa:Os04g0395600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.690

Rank 1 · LXL04_031125 · OH-1004

Cytoplasm0.216

Rank 2 · LXL04_031125 · OH-1004

Cell membrane0.083

Rank 3 · LXL04_031125 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_031125 · OH-1004

Plastid0.042

Rank 5 · LXL04_031125 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18511.7F-box_533-72 aa

PF18791.8Transp_inhibit92-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031125	`PF18511.7`	F-box_5	33	72	2.8e-20	72.3
LXL04_031125	`PF18791.8`	Transp_inhibit	92	138	2.7e-22	78.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTX2`	Arabidopsis thaliana	Transport inhibitor response 1-like protein	71.454%	Swiss-Prot	strong database homology
`Q8RWQ8`	Arabidopsis thaliana	F-box protein FBX14	70.312%	Swiss-Prot	strong database homology
`Q9LPW7`	Arabidopsis thaliana	Protein AUXIN SIGNALING F-BOX 3	49.915%	Swiss-Prot	moderate database homology
`Q9LW29`	Arabidopsis thaliana	Protein AUXIN SIGNALING F-BOX 2	51.111%	Swiss-Prot	strong database homology
`Q7XVM8`	Oryza sativa subsp. japonica	Transport inhibitor response 1-like protein Os04g0395600	50.611%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card