TkA05G025860 | RubberDandelionOmics

Gene overview

TkA05G025860

Reference: TK1151 Chr: Chr05 Coordinates: 7038288-7040875 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · TkA05G025860|TK1151|cDNA

TAATATCTATTCTAAATTCATGGGAGTTTTCAGGATGATGAGTACAAGAACATAATGATGAAGGTTGATGCTGCTAAAGCTAAGTTGAAGGGTATAATGGACAATTTTAAGGTTGGTATTGCTTATACAGTTAATAAATGCAAGGAGTGTTTTATTATGTTCCTATTTGTGTGAATTGCAGCTGGAGCTAAGAGGTATGACTAGTGAGTGAGGCCCTGGAAGAGGATTAATTTGATAAGCAAATCAATTAGATGGACATA...

CDS

Download CDS FASTA

531 bp · TkA05G025860|TK1151|CDS

ATGGATGCATTACCAGGTTTTAAAGGTGGCAATGCTGATTATGCCATGGATTTGCACCAGAAGGAACAGCTTCATGATCCCAATGTTTCAAAGATGCAGTCTCCACATTTCTCCATGGGGAGGTCTTCGGGGTTCAACTTGGGAGGGGCATTTTCGCCACATCGTCCACAACAACAAACTAGCAGTCTCATCTTTTGCACCATCAAACAATCAAGAGCTTCCCCATATGGATATGTTCCAACAAGGATCACATTCATCAT...

Protein

Download Protein FASTA

177 aa · TkA05G025860|TK1151|PROTEIN

MDALPGFKGGNADYAMDLHQKEQLHDPNVSKMQSPHFSMGRSSGFNLGGAFSPHRPQQQTSSLIFCTIKQSRASPYGYVPTRITFIISFTAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRLLFQQNTWESRWFLSDLLAACNYAGPNGFWCYKSITYHYRVGRTRLSCHR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G025860`
TK1151 ID	TkA05G025860
OH-1004 ID	LXL04_036479
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 34.463 / OH-1004 9.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G025860

Location Chr05:7038288-7040875 (+)

Description Similar to VIP2: Probable NOT transcription complex subunit VIP2 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21180`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At5g59710`	Transcriptional regulator required for Agrobacterium-mediated stable genetic transformation by T-DNA integration in host genome, but not for T-DNA transient expression.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release
`At3g24430`	Required for photosystem I (PSI) biosynthesis and assembly.	A novel protein for photosystem I biogenesis.2004 · DOI: 10.1074/jbc.m309246200 The universally conserved HCF101 protein is involved in assembly of [4Fe-4S]-cluster-containing complexes in Arabidopsis thaliana chloroplasts.2004 · DOI: 10.1046/j.1365-313x.2003.01952.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0605500`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	No verified direct reference in this release
`Os01g0719700`	Required for photosystem I (PSI) biosynthesis and assembly.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036479 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006417 regulation of translation Biological Process

GO:0010606 positive regulation of cytoplasmic mRNA processing body assembly Biological Process

GO:0015074 DNA integration Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:2000036 regulation of stem cell population maintenance Biological Process

GO:0000932 P-body Cellular Component

KEGG gene cross-reference

ath:AT5G59710

hsa:4848

mmu:72068

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.291

Rank 1 · TkA05G025860 · TK1151

Nucleus0.283

Rank 2 · TkA05G025860 · TK1151

Mitochondrion0.246

Rank 3 · TkA05G025860 · TK1151

Cell membrane0.160

Rank 4 · TkA05G025860 · TK1151

Endoplasmic reticulum0.133

Rank 5 · TkA05G025860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10609ParA91-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G025860	`PF10609`	ParA	91	123	7e-06	26.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU41`	Arabidopsis thaliana	sp\|Q9LU41\|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type	61.500%	Swiss-Prot	Low
`Q9FPW4`	Arabidopsis thaliana	sp\|Q9FPW4\|VIP2_ARATH Probable NOT transcription complex subunit VIP2	71.900%	Swiss-Prot	Low
`Q9SZR1`	Arabidopsis thaliana	sp\|Q9SZR1\|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type	55.700%	Swiss-Prot	Low
`Q6STH5`	Arabidopsis thaliana	sp\|Q6STH5\|HF101_ARATH Fe-S cluster assembly factor HCF101, chloroplastic	84.600%	Swiss-Prot	Low
`Q7X8B5`	Oryza sativa subsp. japonica	sp\|Q7X8B5\|ACA5_ORYSJ Calcium-transporting ATPase 5, plasma membrane-type	61.500%	Swiss-Prot	Low
`Q0JJS8`	Oryza sativa subsp. japonica	sp\|Q0JJS8\|HF101_ORYSJ Fe-S cluster assembly factor HCF101, chloroplastic	91.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card