TkA05G025650 | RubberDandelionOmics

Gene overview

TkA05G025650

Reference: TK1151 Chr: Chr05 Coordinates: 6947455-6949535 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

756 bp · TkA05G025650|TK1151|cDNA

ATGCATATAGAAGTTACTGACACTGTTTGCAGTGCTGATTCTGATGGTCTGAATGGATTTGCTAATGCAGGTGATGATCAAGAATTTGGAACAAGTGGTGTCTATGGTTTTAAATTCATTCCAAGATCCTCACCCACGCACACCTTACCTAGATGGAATAGTGAGCAAACTGCTTGTGTTATTACAGAAGGGGCCTTGACTGCTCTAGCATCAGTTGCTGACTCATCACAGGAACAATTCCAAAAGTATTATGAAGCAGT...

CDS

Download CDS FASTA

756 bp · TkA05G025650|TK1151|CDS

ATGCATATAGAAGTTACTGACACTGTTTGCAGTGCTGATTCTGATGGTCTGAATGGATTTGCTAATGCAGGTGATGATCAAGAATTTGGAACAAGTGGTGTCTATGGTTTTAAATTCATTCCAAGATCCTCACCCACGCACACCTTACCTAGATGGAATAGTGAGCAAACTGCTTGTGTTATTACAGAAGGGGCCTTGACTGCTCTAGCATCAGTTGCTGACTCATCACAGGAACAATTCCAAAAGTATTATGAAGCAGT...

Protein

Download Protein FASTA

251 aa · TkA05G025650|TK1151|PROTEIN

MHIEVTDTVCSADSDGLNGFANAGDDQEFGTSGVYGFKFIPRSSPTHTLPRWNSEQTACVITEGALTALASVADSSQEQFQKYYEAVMPYLKAILVNANDKANRMLRAKAMECISLVGMAVGKEKFRDDAKQVMEVLMSLQGSQMETDDPTTSYILQCLGQDFLPYMSVVMPPLLQSAQLKPDVIITSASSDNELDESDDESLWLFQMPSTSTVNQRSSSQSDKMQGSLKKVLCSNIIHQVCWQFVVIFNH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G025650`
TK1151 ID	TkA05G025650
OH-1004 ID	LXL04_018970
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.300
Protein coverage (%)	TK1151 95.618 / OH-1004 55.402 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G025650`
Location	Chr05:6947455-6949535 (+)
Description	Similar to sal3: Importin subunit beta-3 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018970` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002753 cytoplasmic pattern recognition receptor signaling pathway Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006607 NLS-bearing protein import into nucleus Biological Process GO:0006610 ribosomal protein import into nucleus Biological Process GO:0042307 positive regulation of protein import into nucleus Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component
KEGG gene cross-reference	hsa:26953 hsa:3843 mmu:240614 mmu:70572 spo:2539387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · TkA05G025650 · TK1151

Nucleus0.487

Rank 2 · TkA05G025650 · TK1151

Mitochondrion0.090

Rank 3 · TkA05G025650 · TK1151

Cell membrane0.070

Rank 4 · TkA05G025650 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA05G025650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25574TPR_IMB154-181 aa

PF25780TPR_IPO561-159 aa

PF09361Phasin_262-142 aa

PF13513HEAT_EZ63-115 aa

PF23271HEAT_GCN165-140 aa

PF05004IFRD76-152 aa

PF13513HEAT_EZ106-149 aa

PF23271HEAT_GCN1155-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G025650	`PF25574`	TPR_IMB1	54	181	2.1e-09	37.3
TkA05G025650	`PF25780`	TPR_IPO5	61	159	0.075	14.0
TkA05G025650	`PF09361`	Phasin_2	62	142	0.0099	16.8
TkA05G025650	`PF13513`	HEAT_EZ	63	115	0.0049	18.1
TkA05G025650	`PF23271`	HEAT_GCN1	65	140	0.11	13.3
TkA05G025650	`PF05004`	IFRD	76	152	0.0012	18.5
TkA05G025650	`PF13513`	HEAT_EZ	106	149	0.0049	18.1
TkA05G025650	`PF23271`	HEAT_GCN1	155	197	0.11	13.3
TkA05G025650	`PF13513`	HEAT_EZ	157	175	0.0049	18.1
TkA05G025650	`PF20941`	DUF6848	196	240	0.25	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card