LXL04_018970 | RubberDandelionOmics

Gene overview

LXL04_018970

Reference: OH-1004 Chr: Chr04 Coordinates: 20636608-20640136 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · LXL04_018970|LXL04_018970|OH1004|cDNA

ATGGAAAGTCGGATGGTGCTACACGCGCCTGATGAAGTTATTACCGAGCTTACCGGTGCCGACACTGAGTTAGTGAGCAGATCATGGAACTTATTTGCTATTCTGCTATCCATGGGGCATCCAGTTCTTCCTATTGAACTGGCATCTCGATGCACTTCTTTTAAAGTGTCAACCGAATTTGTCGAATTCGTTTGCTCTATACCTAACTCTCCCCTCTCGCTGACGGATGATGGTTTGGTTACGATTTATTCTGCTGTTTG...

CDS

Download CDS FASTA

1308 bp · LXL04_018970|LXL04_018970|OH1004|CDS

ATGGAAAGTCGGATGGTGCTACACGCGCCTGATGAAGTTATTACCGAGCTTACCGGTGCCGACACTGAGTTAGTGAGCAGATCATGGAACTTATTTGCTATTCTGCTATCCATGGGGCATCCAGTTCTTCCTATTGAACTGGCATCTCGATGCACTTCTTTTAAAGTGTCAACCGAATTTGTCGAATTCGTTTGCTCTATACCTAACTCTCCCCTCTCGCTGACGGATGATGGTTTGGTTACGATTTATTCTGCTGTTTG...

Protein

Download Protein FASTA

435 aa · LXL04_018970|LXL04_018970|OH1004|PROTEIN

MESRMVLHAPDEVITELTGADTELVSRSWNLFAILLSMGHPVLPIELASRCTSFKVSTEFVEFVCSIPNSPLSLTDDGLVTIYSAVCMRLQRFLLSSGRLFKISIPREIETRDCERKRACGDVELMYYRKRKRSRPNISDNADQTALAMLVRISDAFEKFACLLNLFIHIELSHSCACYVMHIEVTDTVCSADSDGLNGFANAGDDQEFGTSGVYGFKFIPRSSPTHTLPRWNSEQTSCVITEGALTALASVADSSQEQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018970`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018970`
Location	Chr04:20636608-20640136 (+)
Description	Similar to sal3: Importin subunit beta-3 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018970` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002753 cytoplasmic pattern recognition receptor signaling pathway Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006607 NLS-bearing protein import into nucleus Biological Process GO:0006610 ribosomal protein import into nucleus Biological Process GO:0042307 positive regulation of protein import into nucleus Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component
KEGG gene cross-reference	hsa:26953 hsa:3843 mmu:240614 mmu:70572 spo:2539387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.474

Rank 1 · LXL04_018970 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_018970 · OH-1004

Mitochondrion0.096

Rank 3 · LXL04_018970 · OH-1004

Cell membrane0.079

Rank 4 · LXL04_018970 · OH-1004

Endoplasmic reticulum0.072

Rank 5 · LXL04_018970 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25574.2TPR_IMB1234-361 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018970	`PF25574.2`	TPR_IMB1	234	361	7.9e-09	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card