TkA05G020100 | RubberDandelionOmics

Gene overview

TkA05G020100

Reference: TK1151 Chr: Chr05 Coordinates: 5496318-5498001 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · TkA05G020100|TK1151|cDNA

CTTACCTCCAAATCTTAACTGACCCCTTCCATACCAAACGGCCATAATCGCTTGGCCGCAAACTCCATTTCCGCCCCCTCTTTTATTTATAACCACACCACTCCCCAAACTCAAACCATTGGCCAAATCTTTTTAACACGTCGTATTACAACTTCTGCTTCTTTCCCACCGCCGATCTCAACGCCGCCGGAGGAGTTCCAAGTATGAGTGTGGGAGTGGCGGAGGATGATTCACGGATCGAAATACATCTTCCTGCCGAC...

CDS

Download CDS FASTA

1017 bp · TkA05G020100|TK1151|CDS

ATGAGTGTGGGAGTGGCGGAGGATGATTCACGGATCGAAATACATCTTCCTGCCGACATTCACTGGGAGATGCTCGATAAATCCAAGTTCTTCTTCCTCGGTGCGGCTTTGTTTTCTGGTGTTTCCGGCATGCTATACCAAGCTCTAGTATTGAAAACTCGACAACAAGTCCAGTTACAAAACACACCGTGCTTCAAGATGGCTGCTTCGGTTCTACGACATGAAGGGTTTAGAGGTTTATATAGAGGGTTTGGGACTTC...

Protein

Download Protein FASTA

338 aa · TkA05G020100|TK1151|PROTEIN

MSVGVAEDDSRIEIHLPADIHWEMLDKSKFFFLGAALFSGVSGMLYQALVLKTRQQVQLQNTPCFKMAASVLRHEGFRGLYRGFGTSLMGTIPARALYMGALEITKSNLRYTTVKMGLSEVKAAAIANAAAGLSAAVVAQLVWTPIDVVSQRLMVQGGKGTNMRSLRSVMYNGGIDAFSKIIQKDGVRGLYKGFGISILTYAPSNAVWWGSYSMAHRWILGGVLSNNDGGGGIKLNSAAVVAGQGLSATIASGFSALVTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G020100`
TK1151 ID	TkA05G020100
OH-1004 ID	LXL04_019113
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G020100`
Location	Chr05:5496318-5498001 (-)
Description	Similar to SLC25A44: Solute carrier family 25 member 44
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019113` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006865 amino acid transport Biological Process GO:0009083 branched-chain amino acid catabolic process Biological Process GO:0015803 branched-chain amino acid transport Biological Process GO:0055085 transmembrane transport Biological Process GO:0120161 regulation of cold-induced thermogenesis Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0005381 iron ion transmembrane transporter activity Molecular Function GO:0015658 branched-chain amino acid transmembrane transporter activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0269394 ddi:DDB_G0280083 hsa:9673 mmu:229517 pon:100172017 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.877

Rank 1 · TkA05G020100 · TK1151

Plastid0.041

Rank 2 · TkA05G020100 · TK1151

Cytoplasm0.039

Rank 3 · TkA05G020100 · TK1151

Nucleus0.026

Rank 4 · TkA05G020100 · TK1151

Cell membrane0.020

Rank 5 · TkA05G020100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr41-110 aa

PF23855DUF7218117-132 aa

PF00153Mito_carr125-220 aa

PF00153Mito_carr243-330 aa

PF23855DUF7218328-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G020100	`PF00153`	Mito_carr	41	110	2.3e-52	175.4
TkA05G020100	`PF23855`	DUF7218	117	132	0.87	10.5
TkA05G020100	`PF00153`	Mito_carr	125	220	2.3e-52	175.4
TkA05G020100	`PF00153`	Mito_carr	243	330	2.3e-52	175.4
TkA05G020100	`PF23855`	DUF7218	328	335	0.87	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card