TkA05G020070 | RubberDandelionOmics

Gene overview

TkA05G020070

Reference: TK1151 Chr: Chr05 Coordinates: 5490518-5491580 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

756 bp · TkA05G020070|TK1151|cDNA

ATGTTAAGTGTTCATCCTTTCATTGTTACAATTGTTATAGTAAACTTCTCATTTTGTCAATATTTTGTCCTTAGTGCCAATAATACTGGTTTGGCAACATGGTATGGGAAAGAAACCGGGTCTGGAAAAGCTGCTGCTTGTGGATGGGACAACGATTCCAAAGATCCCCCATTCTCGTCCATGATAGCAGCAGGAAATGCTAAATTCTTTTTGAAAGGCAAAGGGTGCGGACATTGCTTTGAGGTATTTTGTTCGCGTAA...

CDS

Download CDS FASTA

756 bp · TkA05G020070|TK1151|CDS

ATGTTAAGTGTTCATCCTTTCATTGTTACAATTGTTATAGTAAACTTCTCATTTTGTCAATATTTTGTCCTTAGTGCCAATAATACTGGTTTGGCAACATGGTATGGGAAAGAAACCGGGTCTGGAAAAGCTGCTGCTTGTGGATGGGACAACGATTCCAAAGATCCCCCATTCTCGTCCATGATAGCAGCAGGAAATGCTAAATTCTTTTTGAAAGGCAAAGGGTGCGGACATTGCTTTGAGGTATTTTGTTCGCGTAA...

Protein

Download Protein FASTA

251 aa · TkA05G020070|TK1151|PROTEIN

MLSVHPFIVTIVIVNFSFCQYFVLSANNTGLATWYGKETGSGKAAACGWDNDSKDPPFSSMIAAGNAKFFLKGKGCGHCFEVFCSRKPYCTGKPIKITITDECPGKCNDIPYHFDLSGHAFGAMGPPGKEHALRMLGQINIQFKKVPCSYGSTKIAFKIDKKTNKYWFSTAIEYVNGDGALTKVEMASDGSPLFSPMKNIWGAVWQKDTAVLFKPPYTFRMTNGDGKTVTATKVVPANYKPGSKYSSTVNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G020070`
TK1151 ID	TkA05G020070
OH-1004 ID	LXL04_019111
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.300
Protein coverage (%)	TK1151 98.008 / OH-1004 92.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G020070

Location Chr05:5490518-5491580 (+)

Description Similar to EXPB14: Putative expansin-B14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45110`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0552000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os05g0246300`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os03g0106800`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019111 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65680

ath:AT2G45110

dosa:Os02g0658600

dosa:Os04g0552000

dosa:Os05g0246300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.890

Rank 1 · TkA05G020070 · TK1151

Cytoplasm0.044

Rank 2 · TkA05G020070 · TK1151

Endoplasmic reticulum0.030

Rank 3 · TkA05G020070 · TK1151

Cell membrane0.028

Rank 4 · TkA05G020070 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA05G020070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29515Expansin_N11-126 aa

PF03330DPBB_129-46 aa

PF22514EXPB1_D133-109 aa

PF03330DPBB_163-130 aa

PF01357Expansin_C155-236 aa

PF29344Expansin_middle160-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G020070	`PF29515`	Expansin_N	11	126	2.3e-07	31.7
TkA05G020070	`PF03330`	DPBB_1	29	46	3e-16	60.2
TkA05G020070	`PF22514`	EXPB1_D1	33	109	8.8e-05	23.6
TkA05G020070	`PF03330`	DPBB_1	63	130	3e-16	60.2
TkA05G020070	`PF01357`	Expansin_C	155	236	3.6e-19	69.4
TkA05G020070	`PF29344`	Expansin_middle	160	232	0.07	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHD1`	Arabidopsis thaliana	sp\|Q9SHD1\|EXPB4_ARATH Expansin-B4	41.100%	Swiss-Prot	Medium
`Q7XT40`	Oryza sativa subsp. japonica	sp\|Q7XT40\|EXB15_ORYSJ Expansin-B15	43.300%	Swiss-Prot	Medium
`Q5W6Z9`	Oryza sativa subsp. japonica	sp\|Q5W6Z9\|EXB18_ORYSJ Expansin-B18	42.400%	Swiss-Prot	Medium
`Q8H7T4`	Oryza sativa subsp. japonica	sp\|Q8H7T4\|EXB10_ORYSJ Expansin-B10	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card