LXL04_019111 | RubberDandelionOmics

Gene overview

LXL04_019111

Reference: OH-1004 Chr: Chr04 Coordinates: 23947029-23948715 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · LXL04_019111|LXL04_019111|OH1004|cDNA

ATGGGAGTAGAAACACCTCATATTGCAACAATAAAAATATCGTTAAATATGGTGTCGACTCCTTTTATTGCCGTTACCATcgtttttgtatatatattttcttgTTTGTGTGTTGTCTCTCACAGCAATGGTACTTTCACAAGCGAAAAGTTTTCTTCTGCTTTGGCAACATGGTATGGGGATGAAACCGGTGCCGGAAGTGgcGGAGCTTGTGGATGGCAGGATGATGTGAAAAATCCTCCGTTGTCATCAATGATAGC...

CDS

Download CDS FASTA

828 bp · LXL04_019111|LXL04_019111|OH1004|CDS

ATGGGAGTAGAAACACCTCATATTGCAACAATAAAAATATCGTTAAATATGGTGTCGACTCCTTTTATTGCCGTTACCATCGTTTTTGTATATATATTTTCTTGTTTGTGTGTTGTCTCTCACAGCAATGGTACTTTCACAAGCGAAAAGTTTTCTTCTGCTTTGGCAACATGGTATGGGGATGAAACCGGTGCCGGAAGTGGCGGAGCTTGTGGATGGCAGGATGATGTGAAAAATCCTCCGTTGTCATCAATGATAGC...

Protein

Download Protein FASTA

275 aa · LXL04_019111|LXL04_019111|OH1004|PROTEIN

MGVETPHIATIKISLNMVSTPFIAVTIVFVYIFSCLCVVSHSNGTFTSEKFSSALATWYGDETGAGSGGACGWQDDVKNPPLSSMIAAGNANIFLSGKGCGHCFEILCHQQPYCSAKPIKVTISDECPGACNNVPYHFDLSGFAFGAMAYPGKDHNLRQLGQVMVQYRRIPCNYRGTKIAFKVSEECNPYWFAVALEYADGDGGFGSVEIAPNGTKHFVSMDNIWGAVWKINIDPSFQAPFSFRLTSGHGKTRIANNVIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019111`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019111

Location Chr04:23947029-23948715 (+)

Description Similar to EXPB14: Putative expansin-B14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45110`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At1g65680`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0658600`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os04g0552000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os05g0246300`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019111 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65680

ath:AT2G45110

dosa:Os02g0658600

dosa:Os04g0552000

dosa:Os05g0246300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.329

Rank 1 · LXL04_019111 · OH-1004

Lysosome / Vacuole0.322

Rank 2 · LXL04_019111 · OH-1004

Cytoplasm0.152

Rank 3 · LXL04_019111 · OH-1004

Endoplasmic reticulum0.132

Rank 4 · LXL04_019111 · OH-1004

Cell membrane0.090

Rank 5 · LXL04_019111 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03330.25DPBB_187-167 aa

PF01357.28Expansin_C179-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019111	`PF03330.25`	DPBB_1	87	167	7.3e-15	55.7
LXL04_019111	`PF01357.28`	Expansin_C	179	260	6.2e-20	71.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHD1`	Arabidopsis thaliana	Expansin-B4	44.358%	Swiss-Prot	moderate database homology
`Q9SHY6`	Arabidopsis thaliana	Putative expansin-B2	45.148%	Swiss-Prot	moderate database homology
`Q6H677`	Oryza sativa subsp. japonica	Putative expansin-B14	47.126%	Swiss-Prot	moderate database homology
`Q7XT40`	Oryza sativa subsp. japonica	Expansin-B15	44.697%	Swiss-Prot	moderate database homology
`Q5W6Z9`	Oryza sativa subsp. japonica	Expansin-B18	46.957%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card