TkA05G019810 | RubberDandelionOmics

Gene overview

TkA05G019810

Reference: TK1151 Chr: Chr05 Coordinates: 5440727-5441867 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · TkA05G019810|TK1151|cDNA

ATGGTGTCGACTCCTTTTATTGCCGTTACCATCGTTTTTGTATATATATTTTCTTGTTTGTGTGTTGTCTCTCACAGCAATGGTACTTTCACAAGCGAAAAGTTTTCTTCTGCTTTGGCAACATGGTATGGGGATGAAACCGGTGCCGGAAGTGGCGGAGCTTGTGGATGGCAGGATGATGTGAAAAATCCTCCGTTGTCATCAATGATAGCAGCAGGAAACGCCAACATTTTTTTATCTGGCAAAGGTTGTGGACATTG...

CDS

Download CDS FASTA

780 bp · TkA05G019810|TK1151|CDS

ATGGTGTCGACTCCTTTTATTGCCGTTACCATCGTTTTTGTATATATATTTTCTTGTTTGTGTGTTGTCTCTCACAGCAATGGTACTTTCACAAGCGAAAAGTTTTCTTCTGCTTTGGCAACATGGTATGGGGATGAAACCGGTGCCGGAAGTGGCGGAGCTTGTGGATGGCAGGATGATGTGAAAAATCCTCCGTTGTCATCAATGATAGCAGCAGGAAACGCCAACATTTTTTTATCTGGCAAAGGTTGTGGACATTG...

Protein

Download Protein FASTA

259 aa · TkA05G019810|TK1151|PROTEIN

MVSTPFIAVTIVFVYIFSCLCVVSHSNGTFTSEKFSSALATWYGDETGAGSGGACGWQDDVKNPPLSSMIAAGNANIFLSGKGCGHCFEILCHQQPYCSAKPIKVTISDECPGACNNVPYHFDLSGFAFGAMAYPGKDHNLRQLGQVMVQYRRIPCNYRGTKIAFKVSEECNPYWFAVALEYADGDGGFGSVEIAPNGTKHFVSMDNIWGAVWKINIDPSFQAPFSFRLTSGHGKTRIANNVIPKKFAIGHKYFSNVNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G019810`
TK1151 ID	TkA05G019810
OH-1004 ID	LXL04_019111
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.182 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G019810

Location Chr05:5440727-5441867 (+)

Description Similar to EXPB14: Putative expansin-B14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60570`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0658600`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os04g0552200`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os10g0555900`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019111 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65680

ath:AT2G45110

dosa:Os02g0658600

dosa:Os04g0552000

dosa:Os05g0246300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.378

Rank 1 · TkA05G019810 · TK1151

Lysosome / Vacuole0.302

Rank 2 · TkA05G019810 · TK1151

Cytoplasm0.150

Rank 3 · TkA05G019810 · TK1151

Endoplasmic reticulum0.120

Rank 4 · TkA05G019810 · TK1151

Cell membrane0.077

Rank 5 · TkA05G019810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29515Expansin_N16-132 aa

PF22514EXPB1_D125-56 aa

PF03330DPBB_139-52 aa

PF22514EXPB1_D140-117 aa

PF03330DPBB_171-151 aa

PF01357Expansin_C163-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G019810	`PF29515`	Expansin_N	16	132	2.7e-05	25.0
TkA05G019810	`PF22514`	EXPB1_D1	25	56	0.0028	18.7
TkA05G019810	`PF03330`	DPBB_1	39	52	6.2e-15	55.9
TkA05G019810	`PF22514`	EXPB1_D1	40	117	0.0028	18.7
TkA05G019810	`PF03330`	DPBB_1	71	151	6.2e-15	55.9
TkA05G019810	`PF01357`	Expansin_C	163	244	6.6e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M203`	Arabidopsis thaliana	sp\|Q9M203\|EXPB5_ARATH Expansin-B5	45.400%	Swiss-Prot	Medium
`Q6H677`	Oryza sativa subsp. japonica	sp\|Q6H677\|EXB14_ORYSJ Putative expansin-B14	51.100%	Swiss-Prot	High
`Q7XT39`	Oryza sativa subsp. japonica	sp\|Q7XT39\|EXPB5_ORYSJ Expansin-B5	47.000%	Swiss-Prot	Medium
`Q336T5`	Oryza sativa subsp. japonica	sp\|Q336T5\|EXPB3_ORYSJ Expansin-B3	41.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card