TkA05G019140 | RubberDandelionOmics

Gene overview

TkA05G019140

Reference: TK1151 Chr: Chr05 Coordinates: 5267958-5268616 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA05G019140|TK1151|cDNA

ATGTTAAACTTCTTTGATCCGCTCAACAACCCTAATCGGTGTTTAGGTTCCAAAATGGTTAAAATCATAGCTGGTTCCCGAGTGGAGGTTATGCGTCCATCCCGTGGGTTTGAAAATTCATACTTTGGTGCACAAGTCATAAGAAGAAACCAAACTATAGCTTTGGTAAGATATGAAGAGCTCATTGATGACAATGGTGAACTGCTGGTGGAGAAGCGCAGAATTGAGCACATTAGACCGTACCCGCCAAGAGTCGACCA...

CDS

Download CDS FASTA

372 bp · TkA05G019140|TK1151|CDS

ATGTTAAACTTCTTTGATCCGCTCAACAACCCTAATCGGTGTTTAGGTTCCAAAATGGTTAAAATCATAGCTGGTTCCCGAGTGGAGGTTATGCGTCCATCCCGTGGGTTTGAAAATTCATACTTTGGTGCACAAGTCATAAGAAGAAACCAAACTATAGCTTTGGTAAGATATGAAGAGCTCATTGATGACAATGGTGAACTGCTGGTGGAGAAGCGCAGAATTGAGCACATTAGACCGTACCCGCCAAGAGTCGACCA...

Protein

Download Protein FASTA

123 aa · TkA05G019140|TK1151|PROTEIN

MLNFFDPLNNPNRCLGSKMVKIIAGSRVEVMRPSRGFENSYFGAQVIRRNQTIALVRYEELIDDNGELLVEKRRIEHIRPYPPRVDQVLNEGDHVDAWDGAGWWRGRLLLECKHDYVVCISTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G019140`
TK1151 ID	TkA05G019140
OH-1004 ID	LXL04_019108
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 83.740 / OH-1004 26.076 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G019140

Location Chr05:5267958-5268616 (-)

Description Similar to RCE2: Probable NEDD8-conjugating enzyme Ubc12-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09320`	Heterochromatin-binding protein that preferentially occupies long transposons and specifically recognizes the histone H3 'Lys-9' methylation (H3K9me) marks, with a stronger affinity for dimethylated H3K9 (H3K9me2).	Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin.2018 · DOI: 10.1038/s41467-018-06965-w Plant HP1 protein ADCP1 links multivalent H3K9 methylation readout to heterochromatin formation.2019 · DOI: 10.1038/s41422-018-0104-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019108 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0036211 protein modification process Biological Process

GO:0045116 protein neddylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019787 ubiquitin-like protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G18600

ath:AT4G36800

mmu:22192

xla:446800

xtr:394553

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.684

Rank 1 · TkA05G019140 · TK1151

Cytoplasm0.323

Rank 2 · TkA05G019140 · TK1151

Cell membrane0.054

Rank 3 · TkA05G019140 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA05G019140 · TK1151

Mitochondrion0.027

Rank 5 · TkA05G019140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641Agenet25-83 aa

PF05641Agenet94-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G019140	`PF05641`	Agenet	25	83	5.2e-11	43.6
TkA05G019140	`PF05641`	Agenet	94	121	5.2e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q500V5`	Arabidopsis thaliana	sp\|Q500V5\|AGDP1_ARATH Protein AGENET DOMAIN (AGD)-CONTAINING P1	35.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card