TkA05G016630 | RubberDandelionOmics

Gene overview

TkA05G016630

Reference: TK1151 Chr: Chr05 Coordinates: 4681952-4682914 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA05G016630|TK1151|cDNA

ACAGGTGAAGGTAGTGAAGTCAACGCTCCGTATTCAGATCTGAAAAGAATTCATGGGATTTTAAATGCGGTTGGATGGGGTATATTACTCCCCATAGGTGCTATGGTTGCTCGTTACTTGAAGCATGTAGGTCGATTATGGTTTTATGGACATTCAAGCATCCAACTATCAGGATTTATTCTTGGATTATCAGGTGTAATTTCAGGTCTTATTTTAAATGATCGTCTGGATATCAATGTTGGCAAACACAAAGCCATTGG...

CDS

Download CDS FASTA

522 bp · TkA05G016630|TK1151|CDS

ACAGGTGAAGGTAGTGAAGTCAACGCTCCGTATTCAGATCTGAAAAGAATTCATGGGATTTTAAATGCGGTTGGATGGGGTATATTACTCCCCATAGGTGCTATGGTTGCTCGTTACTTGAAGCATGTAGGTCGATTATGGTTTTATGGACATTCAAGCATCCAACTATCAGGATTTATTCTTGGATTATCAGGTGTAATTTCAGGTCTTATTTTAAATGATCGTCTGGATATCAATGTTGGCAAACACAAAGCCATTGG...

Protein

Download Protein FASTA

173 aa · TkA05G016630|TK1151|PROTEIN

TGEGSEVNAPYSDLKRIHGILNAVGWGILLPIGAMVARYLKHVGRLWFYGHSSIQLSGFILGLSGVISGLILNDRLDINVGKHKAIGLIIITLGCLQIIAVLIRPSKDSKMRKYWKWYHQNVGRILILFAIFNVFYGIYLAHAGTEWNVTYGVFLGIIVTVALSLELRLLTED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G016630`
TK1151 ID	TkA05G016630
OH-1004 ID	LXL04_019075
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 14.088 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G016630

Location Chr05:4681952-4682914 (+)

Description Similar to UBP5: Ubiquitin carboxyl-terminal hydrolase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07570`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g61750`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g25290`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g59070`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At5g35735`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019075 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007032 endosome organization Biological Process

GO:0007265 Ras protein signal transduction Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0141137 positive regulation of gene expression, epigenetic Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

GO:0140950 histone H2A deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G32850

ath:AT2G40930

ath:AT4G10570

ath:AT4G10590

ath:AT5G22030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.670

Rank 1 · TkA05G016630 · TK1151

Cytoplasm0.176

Rank 2 · TkA05G016630 · TK1151

Lysosome / Vacuole0.117

Rank 3 · TkA05G016630 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA05G016630 · TK1151

Golgi apparatus0.065

Rank 5 · TkA05G016630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10348DUF242710-102 aa

PF03188Cytochrom_B56118-138 aa

PF14007YtpI37-100 aa

PF10348DUF2427118-141 aa

PF14007YtpI120-138 aa

PF14007YtpI155-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G016630	`PF10348`	DUF2427	10	102	0.053	14.0
TkA05G016630	`PF03188`	Cytochrom_B561	18	138	0.00023	22.1
TkA05G016630	`PF14007`	YtpI	37	100	1.5	10.0
TkA05G016630	`PF10348`	DUF2427	118	141	0.053	14.0
TkA05G016630	`PF14007`	YtpI	120	138	1.5	10.0
TkA05G016630	`PF14007`	YtpI	155	159	1.5	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRW8`	Arabidopsis thaliana	sp\|Q0WRW8\|B561K_ARATH Cytochrome b561 and DOMON domain-containing protein At3g07570	52.400%	Swiss-Prot	High
`Q9M363`	Arabidopsis thaliana	sp\|Q9M363\|B561I_ARATH Cytochrome b561 and DOMON domain-containing protein At3g61750	39.600%	Swiss-Prot	Medium
`Q9LSE7`	Arabidopsis thaliana	sp\|Q9LSE7\|B561C_ARATH Cytochrome b561 and DOMON domain-containing protein At3g25290	40.700%	Swiss-Prot	Medium
`Q9LYS9`	Arabidopsis thaliana	sp\|Q9LYS9\|B561H_ARATH Cytochrome b561 and DOMON domain-containing protein At3g59070	39.400%	Swiss-Prot	Medium
`Q9FKH6`	Arabidopsis thaliana	sp\|Q9FKH6\|B561P_ARATH Cytochrome b561 and DOMON domain-containing protein At5g35735	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card