RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_019075
Reference: OH-1004 Chr: Chr04 Coordinates: 23166643-23181990 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3687 bp · LXL04_019075|LXL04_019075|OH1004|cDNA

ATGGTGGACGTTTCAGCCACGGCCGGTAGTTCGAGAGAACTTTCGCCGGAGGAAGAGATGCAGATCATACATTCCACTTCAATGGCAGCCGAACCTCTAACCAAAGCAGGCGATACGTTTTGTTTAATTAGTCGGAGATGGTGGGAGAAATGGATTAGTTATGTAACTCACAGCAAGACAGGTGGCACAAATGAAGGATCATCTTCAGATCATCATGACCATTCAAAGACTCCAAAAAGGCCATCAAGCATCGACAATTC...

CDS

Download CDS FASTA

3687 bp · LXL04_019075|LXL04_019075|OH1004|CDS

ATGGTGGACGTTTCAGCCACGGCCGGTAGTTCGAGAGAACTTTCGCCGGAGGAAGAGATGCAGATCATACATTCCACTTCAATGGCAGCCGAACCTCTAACCAAAGCAGGCGATACGTTTTGTTTAATTAGTCGGAGATGGTGGGAGAAATGGATTAGTTATGTAACTCACAGCAAGACAGGTGGCACAAATGAAGGATCATCTTCAGATCATCATGACCATTCAAAGACTCCAAAAAGGCCATCAAGCATCGACAATTC...

Protein

Download Protein FASTA

1228 aa · LXL04_019075|LXL04_019075|OH1004|PROTEIN

MVDVSATAGSSRELSPEEEMQIIHSTSMAAEPLTKAGDTFCLISRRWWEKWISYVTHSKTGGTNEGSSSDHHDHSKTPKRPSSIDNSDLIYEAASINSTMGIELHDTLVEHTDYILVPEETWNQLCSWYGGGPKLDRKVISGGQSQTELSVEVYPLRLRLHLMPKGDQCAIRISKKETIGTLHKKACEIFHLNSEQVSIWDYYSHRKHALMNDLDKTLDDANIQMDQDILVEAIDDGGGCTNDVQENGFAKNEPTALPEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_019075
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_019075
LocationChr04:23166643-23181990 (+)
DescriptionSimilar to UBP5: Ubiquitin carboxyl-terminal hydrolase 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g40930 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.
Ubiquitin-specific proteases from Arabidopsis thaliana: cloning of AtUBP5 and analysis of substrate specificity of AtUBP3, AtUBP4, and AtUBP5 using Escherichia coli in vivo and in vitro assays.2000 · DOI: 10.1006/abbi.2000.1874
At4g10570 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
At4g10590 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
At1g32850 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
At5g22030 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019075 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0007032 endosome organization Biological Process
GO:0007265 Ras protein signal transduction Biological Process
GO:0016579 protein deubiquitination Biological Process
GO:0141137 positive regulation of gene expression, epigenetic Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0004843 cysteine-type deubiquitinase activity Molecular Function
GO:0140950 histone H2A deubiquitinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G32850
ath:AT2G40930
ath:AT4G10570
ath:AT4G10590
ath:AT5G22030
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.305
Rank 1 · LXL04_019075 · OH-1004
Cytoplasm0.286
Rank 2 · LXL04_019075 · OH-1004
Cell membrane0.205
Rank 3 · LXL04_019075 · OH-1004
Golgi apparatus0.187
Rank 4 · LXL04_019075 · OH-1004
Nucleus0.186
Rank 5 · LXL04_019075 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06337.18DUSP37-140 aa
PF25242.2Ubiquitin_UBP8158-202 aa
PF00443.36UCH318-885 aa
PF13423.13UCH_1737-867 aa
PF03351.23DOMON960-1005 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_019075PF06337.18DUSP371403.1e-2279.5
LXL04_019075PF25242.2Ubiquitin_UBP81582021.6e-0938.0
LXL04_019075PF00443.36UCH3188851.7e-77261.2
LXL04_019075PF13423.13UCH_17378673.4e-1350.6
LXL04_019075PF03351.23DOMON96010058.7e-0833.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22207Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 564.333%Swiss-Protstrong database homology
Q9ZSB5Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 1047.380%Swiss-Protmoderate database homology
Q93Y01Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 947.687%Swiss-Protmoderate database homology
Q9MAQ3Arabidopsis thalianaPutative ubiquitin carboxyl-terminal hydrolase 1146.060%Swiss-Protmoderate database homology
Q9C585Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 844.378%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser