TkA05G012810 | RubberDandelionOmics

Gene overview

TkA05G012810

Reference: TK1151 Chr: Chr05 Coordinates: 3659573-3663192 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2104 bp · TkA05G012810|TK1151|cDNA

AAATTGACTCTTCTATGGTTGGATGGATGTATATATAGGTAGAGGTGTTTATGACTTGATCACAGAATTAAAGGAGAATTATAGATTGAGCTTTTCAACTGTAGAGAGAAAATGGACAGCACTTTGGAGTCGATGAAGGATGGAGTCCACCGTTGGTGGTGGCGTTGAGGACGTCTACGGTGAAGATCGTGCAACCGAGGACCAACTCGTCACGCCTTGGACTACTTCCGTCGCTAGTGGATACACTTTGATGAGAGATC...

CDS

Download CDS FASTA

1470 bp · TkA05G012810|TK1151|CDS

ATGAAGTTCCATTACACAATACGTGGCTATGATGAACTTGAGGAGCGAAATGAGAGACTGTTCTACAAGCTTCTTATTGACCATGTCGAAGAACTTCTCCCTATTGTCTACACTCCTACAGTTGGTGAGGCTTGCCAGAATACGGGAGTATCTTCAAGCGCGCCTCAGGGTCTCTACATTAGTTTGAAAGAGAAGGGAAAGATTCTTGAGGTACTCAGGAACTGGCCTGAGAGGAGTATCCAAGTTATTGTGGTGACAGA...

Protein

Download Protein FASTA

489 aa · TkA05G012810|TK1151|PROTEIN

MKFHYTIRGYDELEERNERLFYKLLIDHVEELLPIVYTPTVGEACQNTGVSSSAPQGLYISLKEKGKILEVLRNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNQKLLDDEFYIGLKQRRTTGKEYYELLEEFMSAVKQNYGEKVLVQFEDFANHNAFELLAKYKTSHLVFNDDIQGTASVVLAGLVASLKLLGGSLADHTFLFLGAGEAGTGIAELIALEISTKTNVPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G012810`
TK1151 ID	TkA05G012810
OH-1004 ID	LXL04_019035
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 97.751 / OH-1004 81.990 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G012810

Location Chr05:3659573-3663192 (+)

Description Similar to NADP-dependent malic enzyme

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0188400`	The chloroplastic ME isoform decarboxylates malate shuttled from neighboring mesophyll cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019035 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006108 malate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004473 malate dehydrogenase (decarboxylating) (NADP+) activity Molecular Function

GO:0008948 oxaloacetate decarboxylase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

vvi:100233140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.714

Rank 1 · TkA05G012810 · TK1151

Nucleus0.196

Rank 2 · TkA05G012810 · TK1151

Mitochondrion0.100

Rank 3 · TkA05G012810 · TK1151

Plastid0.096

Rank 4 · TkA05G012810 · TK1151

Peroxisome0.075

Rank 5 · TkA05G012810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00390malic15-195 aa

PF03949Malic_M205-458 aa

PF26041DUF8011206-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G012810	`PF00390`	malic	15	195	7.6e-77	258.0
TkA05G012810	`PF03949`	Malic_M	205	458	8.7e-97	324.2
TkA05G012810	`PF26041`	DUF8011	206	248	0.042	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43279`	Oryza sativa subsp. japonica	sp\|P43279\|MAOC_ORYSJ NADP-dependent malic enzyme, chloroplastic	78.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card