TkA05G011580 | RubberDandelionOmics

Gene overview

TkA05G011580

Reference: TK1151 Chr: Chr05 Coordinates: 3307690-3310173 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

749 bp · TkA05G011580|TK1151|cDNA

CTTTATTTGGCTCCTGCCAAAATACTCCACAAAAAAAATATGGTCTTCTTCTTTCTTGTTCCTGGCCTCCTGACGACGCAAGCACAAATTTTTTTTCTGCCGCTGCACTTCTTGCCGGCAATTTTCACATTGATTCTCACCGGAGGAGCAACAACACCGTCACCTCCGGCATCTTCTTCTGGGATCACCAGCCTTCCATGGAAGGATATAAAAGCGAGGAAGCTTGGGATTCGGGAAATAATTGAGAAGAAATCATCAAC...

CDS

Download CDS FASTA

441 bp · TkA05G011580|TK1151|CDS

ATGGTCTTCTTCTTTCTTGTTCCTGGCCTCCTGACGACGCAAGCACAAATTTTTTTTCTGCCGCTGCACTTCTTGCCGGCAATTTTCACATTGATTCTCACCGGAGGAGCAACAACACCGTCACCTCCGGCATCTTCTTCTGGGATCACCAGGTTGTCATTGAATAAGTGTGGCCACCAACCACACTTAGACTTTGAGATTCCAACACTTAGAGGAAGCCTTCCATGGAAGGATATAAAAGCGAGGAAGCTTGGGATTCG...

Protein

Download Protein FASTA

146 aa · TkA05G011580|TK1151|PROTEIN

MVFFFLVPGLLTTQAQIFFLPLHFLPAIFTLILTGGATTPSPPASSSGITRLSLNKCGHQPHLDFEIPTLRGSLPWKDIKARKLGIREIIEKKSSTPIELLCESQAVEFASYLHYCQSLRFDQRPDYGFLKSLFRELFTREDRKEW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G011580`
TK1151 ID	TkA05G011580
OH-1004 ID	LXL04_019017
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 49.315 / OH-1004 13.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G011580

Location Chr05:3307690-3310173 (+)

Description Similar to CKL3: Casein kinase 1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28860`	Protein kinase involved in blue light responses (e.g. hypocotyl elongation and flowering) by phosphorylating CRY2 to reduce its stability.	No verified direct reference in this release
`At4g28880`	Protein kinase involved in blue light responses (e.g. hypocotyl elongation and flowering) by phosphorylating CRY2 to reduce its stability.	No verified direct reference in this release
`At5g44100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g57015`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At3g23340`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0622100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Roles of OsCKI1, a rice casein kinase I, in root development and plant hormone sensitivity.2003 · DOI: 10.1046/j.1365-313x.2003.01866.x Rice LTG1 is involved in adaptive growth and fitness under low ambient temperature.2014 · DOI: 10.1111/tpj.12487

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009637 response to blue light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G03930

ath:AT4G28860

ath:AT4G28880

ath:AT5G44100

dosa:Os02g0622100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · TkA05G011580 · TK1151

Nucleus0.353

Rank 2 · TkA05G011580 · TK1151

Mitochondrion0.150

Rank 3 · TkA05G011580 · TK1151

Endoplasmic reticulum0.113

Rank 4 · TkA05G011580 · TK1151

Cell membrane0.106

Rank 5 · TkA05G011580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPI7`	Arabidopsis thaliana	sp\|Q8LPI7\|CKL4_ARATH Casein kinase 1-like protein 4	67.600%	Swiss-Prot	Medium
`Q93Z18`	Arabidopsis thaliana	sp\|Q93Z18\|CKL3_ARATH Casein kinase 1-like protein 3	66.200%	Swiss-Prot	Medium
`Q9FFH8`	Arabidopsis thaliana	sp\|Q9FFH8\|CKL7_ARATH Casein kinase 1-like protein 7	60.800%	Swiss-Prot	Medium
`Q8VYK9`	Arabidopsis thaliana	sp\|Q8VYK9\|CKL12_ARATH Casein kinase 1-like protein 12	59.500%	Swiss-Prot	Medium
`Q9LW62`	Arabidopsis thaliana	sp\|Q9LW62\|CKL10_ARATH Casein kinase 1-like protein 10	56.300%	Swiss-Prot	Low
`Q6K9N1`	Oryza sativa subsp. japonica	sp\|Q6K9N1\|CKI1_ORYSJ Casein kinase 1	58.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card